Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR227 IGR225 IGR223 IGR226 IGR229 IGR228 IGR224 CPn0276 CPn0277 CPn0278 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0271 CPn0276 CPn0277 CPn0278 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0271 CPn0276 CPn0278 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 tdk, - CPn0273 tdk, - CPn0273 CPn0277 ywlC, - CPn0270 CPn0271
* Calculated from Protein Sequence

Gene ID: CPn0274

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gyrA  

Definition:
DNA gyrase subunit A (topoisomerase)

Gene Start:
308353

Gene Stop:
305849

Gene Length:
2505

Molecular Weight*:
93804

pI*:
7.00

Net Charge*:
0.45

EC:
5.99.1.3  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
The A subunit of this enzyme is mainly involved
in DNA breakage and rejoining; a
phosphotyrosine bond is transiently formed
between this subunit and DNA during the
cleavage. Two A chains and two B chains make up
the gyrase protein.

Blast Summary:  PSI-Blast Search
CPn0274 is similar to TP0005 in T. pallidum, UU082 and UU467 in U. urealyticum, MG004 and MG204 in M. genitalium. They are all predicted DNA gyrase/topoisomerase subunit A.

CPn0274 is orthologously related to CT189, a predicted DNA gyrase subunit A: residues 1-831 are 82% similar to CT189.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0188
COG name: DNA gyrase (topoisomerase II) A subunit
Functional Class:  L
The phylogenetic pattern of COG0188 is a---yqvCEBrHujGPOlINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0274 is paralogously related to CPn0716, a predicted DNA gyrase subunit A: residues 11-351 are 32% similar to CPn0716.

Pfam Summary:  Pfam Search
Residues 32 to 480 (E-value = 1.2e-287) place CPn0274 in the DNA_topoisoIV family which is described as DNA gyrase/topoisomerase IV, subunit A (PF00521)
Residues 504 to 554 (E-value = 1.8e-08) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 555 to 608 (E-value = 9.2e-12) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 612 to 659 (E-value = 9.5e-08) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 661 to 711 (E-value = 7e-16) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 712 to 762 (E-value = 3.6e-11) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)
Residues 763 to 812 (E-value = 7.1e-15) place CPn0274 in the DNA_gyraseA_C family which is described as DNA gyrase C-terminal domain, beta-propeller (PF03989)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
430  
478

PDB Hit:


Gene Protein Sequence:
MFNKDEIIVPKNLEEEMKESYLRYSMSVIISRALPDIRDGLKPSQRRVLY
AMKQLSLSPGAKHRKCAKICGDTSGDYHPHGESVIYPTLVRMAQNWAMRY
PLVDGQGNFGSIDGDPPAAMRYTEARLTHSAMYLMEDLDKDTVDIVPNYD
ETKHEPVVFPSKFPNLLCNGSSGIAVGMATNIPPHNLGELIEATLLLLAN
PQASVDEILQVMPGPDFPTGGIICGSEGIRSAYTTGRGKIKVRARLHVEE
NEDKHRESIIITEMPYNVNKSRLIEQIANLVNEKTLAGISDVRDESDKDG
IRVVLEIKKGESSEIIINRLYKFTDVQVTFGANMLALDKNLPRTMSIHRM
ISAWIRHRKEVIRRRTRYELNKAETRAHVLEGYLKALSCLDALVKTIRES
GNKEHAKERIIESFGFTEPQALAILELRLYQLTGLEAEKIQKEYEELLNK
IAYYKQVLSDEGLVKDIIRNELQDLLKHHKVARRTTIEFDADDIRDIEDI
ITNESVIITISGDDYVKRMPVKVFKEQRRGGHGVTGFDMKKGAGFLKAVY
SAFTKDYLLIFTNFGQCYWLKVWQLPEGERRAKGKPIINFLEGIRPGEEL
AAILNIKNFDNAGFLFLATKRGVVKKVSLDAFSNPRKKGIRALEIDEGDE
LIAACHIVSDEEKVMLFTHLGMAVRFPHEKVRPMGRTARGVRGVSLKNEE
DKVVSCQIVTENQSVLIVCDQGFGKRSLVEDFRETNRGGVGVRSILINER
NGNVLGAIPVTDHDSILLMSSQGQAIRINMQDVRVMGRSTQGVRLVHLKE
GDALVSMEKLSSNENDDEVLSGSEEECSDTVSLR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAATAAAGATGAAATTATAGTCCCTAAAAATCTTGAAGAAGAGAT
GAAGGAAAGTTACCTTCGTTATTCGATGTCTGTGATTATATCTCGGGCTC
TTCCAGATATCCGGGATGGACTCAAGCCTTCACAAAGAAGAGTTCTTTAT
GCCATGAAGCAGCTAAGTCTTTCTCCAGGAGCTAAGCATCGTAAATGTGC
AAAAATTTGTGGGGATACCTCTGGAGACTACCATCCACATGGTGAGAGCG
TCATTTATCCTACGCTTGTCCGTATGGCTCAGAACTGGGCGATGCGTTAT
CCTTTGGTGGACGGACAAGGAAACTTCGGCTCCATAGACGGAGATCCACC
TGCTGCTATGCGATACACAGAAGCTCGTCTTACCCATAGTGCTATGTATC
TTATGGAAGACTTGGACAAAGATACTGTGGATATTGTTCCAAACTATGAT
GAAACAAAACACGAGCCTGTAGTTTTTCCTTCTAAATTTCCGAATCTTCT
TTGCAATGGTTCTTCAGGAATTGCTGTTGGGATGGCAACGAATATCCCCC
CACACAATTTAGGGGAACTTATAGAAGCTACACTTCTTCTGCTTGCAAAT
CCACAGGCTTCTGTGGATGAGATTTTACAAGTCATGCCAGGCCCTGATTT
CCCTACAGGAGGAATTATCTGCGGTTCTGAAGGAATTCGCTCCGCGTATA
CTACAGGACGAGGAAAGATTAAAGTTCGAGCTCGTCTGCATGTAGAAGAG
AATGAAGATAAACATCGTGAGAGCATCATCATCACAGAGATGCCTTATAA
TGTGAATAAATCACGTTTGATTGAGCAAATTGCAAATCTTGTGAATGAAA
AGACTCTCGCAGGCATTTCAGATGTTCGCGATGAGTCTGATAAAGATGGA
ATCCGTGTTGTCCTTGAAATCAAAAAAGGAGAATCTTCGGAAATCATTAT
CAATAGGCTCTACAAGTTCACCGATGTTCAGGTAACTTTTGGGGCAAATA
TGCTTGCCCTGGATAAGAACTTACCTAGAACGATGAGTATTCATAGGATG
ATTTCCGCTTGGATACGCCATCGTAAAGAAGTCATCCGTCGTAGGACTCG
TTATGAATTAAATAAAGCAGAAACACGAGCTCATGTTTTAGAAGGATACC
TTAAGGCTTTATCTTGCTTAGATGCATTAGTAAAAACGATCCGCGAGAGT
GGGAATAAAGAGCATGCTAAAGAACGGATTATTGAATCTTTTGGTTTTAC
CGAACCTCAAGCTCTTGCGATTTTAGAACTGCGTTTATATCAACTTACTG
GTTTAGAAGCTGAAAAGATTCAAAAAGAGTACGAAGAGTTATTAAATAAG
ATAGCTTATTATAAACAAGTTTTATCGGATGAAGGTTTAGTAAAAGATAT
CATCAGAAATGAGTTACAAGATCTTTTGAAGCATCATAAGGTAGCTCGAC
GCACTACTATAGAATTCGATGCTGATGATATTCGTGATATTGAAGACATC
ATTACCAATGAGTCTGTTATTATCACGATATCCGGAGATGATTACGTAAA
GAGAATGCCTGTAAAAGTGTTCAAAGAACAACGTCGTGGCGGGCATGGAG
TTACGGGATTTGATATGAAGAAGGGAGCAGGGTTCCTTAAAGCTGTATAC
TCTGCCTTTACTAAAGACTATCTCTTAATCTTCACCAATTTTGGCCAATG
TTATTGGTTGAAGGTATGGCAGCTCCCAGAAGGGGAGCGGAGGGCGAAAG
GTAAGCCCATCATCAACTTCCTAGAGGGAATTCGTCCTGGTGAGGAGCTC
GCAGCTATATTGAATATTAAGAATTTTGATAATGCCGGCTTCTTATTTTT
AGCCACCAAACGTGGTGTTGTGAAAAAAGTTTCCTTAGACGCCTTTAGCA
ACCCTAGGAAAAAGGGAATACGTGCTTTAGAGATAGATGAGGGAGACGAA
CTCATAGCAGCTTGTCACATTGTTAGTGATGAAGAGAAGGTAATGTTATT
TACTCATCTTGGTATGGCAGTTCGCTTCCCCCATGAAAAAGTTCGTCCTA
TGGGTAGAACTGCACGTGGGGTTCGCGGTGTCTCTTTGAAAAATGAAGAA
GATAAAGTTGTCAGTTGTCAAATTGTGACTGAGAACCAGTCGGTTTTAAT
TGTATGTGATCAAGGTTTTGGTAAGAGATCTTTAGTTGAAGATTTCCGCG
AAACCAATCGTGGAGGCGTGGGCGTACGTTCTATCCTTATCAATGAAAGA
AACGGCAATGTCCTAGGAGCTATTCCTGTTACGGATCACGACAGTATTTT
ATTAATGTCGAGTCAGGGACAGGCAATTCGCATTAACATGCAAGATGTTA
GAGTGATGGGAAGATCGACTCAAGGGGTGCGTTTAGTTCACTTGAAAGAA
GGGGATGCTCTTGTTTCTATGGAAAAACTCTCTTCTAATGAAAATGATGA
TGAAGTACTATCAGGGTCCGAAGAAGAATGTTCTGATACAGTAAGCCTAA
GGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy