Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR225 IGR223 IGR226 IGR221 IGR222 IGR224 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 tdk, - CPn0273 tdk, - CPn0273 CPn0271 CPn0267 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0273

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tdk  

Definition:
thymidylate kinase (DTMP)

Gene Start:
305844

Gene Stop:
305224

Gene Length:
621

Molecular Weight*:
22805

pI*:
6.80

Net Charge*:
-0.84

EC:
2.7.4.9  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; salvage of nucleosides and nucleotides  

Pathway: pathway table
Pyrimidine metabolism

Comment:
In B.subtilis, this enzyme phosphorylates dTMP to form dTDP.

Blast Summary:  PSI-Blast Search
CPn0273 is orthologously related to CT188, a predicted thymidylate kinase:
residues 1-206 are 54% similar to CT188. CPn0273 is weakly similar to
MG006, UU020, and TP0354.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0125
COG name: Thymidylate kinase
Functional Class: F
The phylogenetic pattern of COG0125 is AmTkyqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 196 (E-value = 8.4e-81) place CPn0273 in the Thymidylate_kin family which is described as Thymidylate kinase (PF02223)

PDB Hit:


Gene Protein Sequence:
VFIVIEGGEGSGKSSLAKALGDQLVAQDRKVLLTREPGGCLIGERLRDLI
LEPPHLELSRCCELFLFLGSRAQHIQEVIIPALRDGYIVICERFHDSTIV
YQGIAEGLGADFVADLCSKVVGPTPFLPNFVLLLDIPADIGLQRKHRQKV
FDKFEKKPLSYHNRIREGFLSLASADPSRYLVLDARESLASLIDKVMLHT
QLGLCT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTTATCGTGATTGAGGGGGGCGAAGGGTCTGGCAAAAGTTCTTTAGC
AAAGGCTTTAGGAGATCAGCTAGTAGCTCAAGATCGGAAGGTTTTGTTAA
CAAGGGAACCTGGAGGGTGCCTTATAGGCGAAAGACTCCGAGATTTAATT
TTGGAACCTCCTCACTTAGAACTCTCTCGCTGTTGTGAACTCTTTTTGTT
TCTTGGATCACGTGCTCAACATATTCAGGAAGTGATCATTCCCGCATTGC
GTGATGGCTATATTGTCATTTGTGAGAGATTCCACGATTCCACGATTGTG
TATCAGGGAATAGCCGAAGGTTTGGGTGCTGATTTTGTTGCCGACCTTTG
TTCTAAGGTTGTAGGACCTACACCTTTCCTTCCTAATTTTGTTTTACTCT
TGGATATTCCTGCAGACATTGGCTTACAAAGGAAGCACCGACAAAAGGTT
TTTGACAAGTTTGAAAAAAAGCCTTTGAGCTATCATAACAGGATCCGAGA
AGGATTTTTATCTCTTGCTAGTGCCGATCCTAGTCGTTACTTGGTTCTTG
ATGCTCGTGAATCACTAGCTAGTTTAATAGACAAAGTGATGCTACATACG
CAACTTGGGTTATGCACCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy