Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR225 IGR223 IGR226 IGR221 IGR222 IGR220 IGR224 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 tdk, - CPn0273 tdk, - CPn0273 CPn0271 CPn0267 CPn0268 CPn0266
* Calculated from Protein Sequence

Gene ID: CPn0272

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaX  dnaZ  

Definition:
DNA polymerase III subunits gamma and tau

Gene Start:
305233

Gene Stop:
304337

Gene Length:
897

Molecular Weight*:
33963

pI*:
7.00

Net Charge*:
0.04

EC:
 2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
The gamma and tau subunits assist in core
formation but are not themselves
constituents of the core pol III. The two
proteins are made from the
same coding region, sharing the first 80% in
E.coli; the gamma chain
results from programmed frameshifting. See CPn0040.

Blast Summary:  PSI-Blast Search
CPn0272 is weakly similar to UU087 in U. urealyticum, TP1005 in T. pallidum and MG420 in M. genitalium. They are all predicted DNA polymerase III gamma-tau subunits.

CPn0272 is orthologously related to CT187: residues 6-285 are 45% similar to CT187. CPn0272 is also weakly similar to CT334.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0470
COG name: ATPase involved in DNA replication
Functional Class:  L
The phylogenetic pattern of COG0470 is AMTKYQVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0272 is paralogously related to CPn0040, a predicted DNA polymerase III gammma and tau subunit: residues 85 -165 are 36% similar to CPn0272.



Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
189  
216
non-globular  
218  
298

PDB Hit:


Gene Protein Sequence:
MHLEEENQGWEALLRKVYHQEVPPAILLHGFTLPVLQDKAEQLASEILLS
SSPGSEHKVSQKIHPDIYQFFPEGKGRLHSIDLPRGIKKQIYISPFEANY
KIYIIHEADRMTLAAISAFLKVFEEPPKHAVIILTTAKVQRLPKTIISRS
LSIFIERGEKILCSKETFSYLFRYAQCEIPVTEVSQIIKESSETDKQVLR
DKVQRFMEVLLELYRDRYTLNLGLKASALNYPEHVKEILQLPLLPLDKVL
LIVESACRSLNNSSSAASVLEWVAIQLVSLQYKEKELVSVSPGQDLSN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACCTAGAAGAAGAGAATCAAGGCTGGGAAGCTTTACTTAGGAAAGT
TTATCATCAGGAAGTGCCTCCAGCTATACTGCTGCATGGATTTACCCTTC
CTGTTTTACAGGATAAAGCAGAACAGTTAGCATCGGAGATTTTGCTATCG
TCATCTCCAGGTTCCGAACATAAAGTTTCTCAAAAGATTCATCCCGATAT
TTATCAATTCTTTCCAGAAGGAAAGGGAAGACTGCACTCTATAGATCTTC
CTAGGGGAATTAAGAAGCAGATTTATATATCTCCTTTTGAAGCAAACTAT
AAGATCTACATTATTCACGAAGCAGATCGAATGACTTTAGCTGCGATTTC
CGCATTTTTAAAAGTCTTCGAAGAACCTCCGAAACATGCTGTTATCATAT
TGACAACAGCAAAAGTTCAGAGATTGCCAAAGACTATCATTTCTCGGAGT
CTCTCTATTTTTATTGAGAGGGGAGAAAAAATCTTATGTTCCAAAGAGAC
GTTTTCTTATTTATTTCGCTATGCCCAATGTGAAATTCCCGTTACTGAAG
TGTCTCAAATTATAAAAGAATCTTCAGAGACAGATAAACAGGTGTTAAGA
GACAAGGTGCAACGATTCATGGAAGTGCTCCTAGAGCTATATCGAGATCG
TTATACTCTGAATTTAGGATTAAAGGCTTCAGCTTTAAACTATCCTGAGC
ATGTTAAGGAGATCCTACAATTGCCATTACTGCCTTTAGATAAGGTGCTT
TTAATTGTGGAATCTGCCTGTCGGTCATTGAATAACTCCTCATCGGCAGC
ATCTGTTTTAGAATGGGTAGCTATTCAGTTGGTATCTCTCCAGTATAAAG
AAAAGGAACTCGTTTCTGTCAGCCCCGGGCAGGATCTATCCAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy