Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR225 IGR223 IGR226 IGR221 IGR222 IGR220 IGR224 IGR219 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 dnaX,dnaZ, - CPn0272 CPn0269 gyrB, - CPn0275 gyrA, - CPn0274 tdk, - CPn0273 tdk, - CPn0273 CPn0266 CPn0271 CPn0267 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0271

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
lysophospholipase esterase

Gene Start:
303634

Gene Stop:
304365

Gene Length:
732

Molecular Weight*:
27206

pI*:
5.00

Net Charge*:
-8.55

EC:
 

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0271 is paralogously related to CT136, a probable serine esterase: residues 4-237 are 53% similar to CT136.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0400
COG name: Carboxylesterases
Functional Class: R
The phylogenetic pattern of COG0400 is ----y--ce---------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 238 (E-value = 9.4e-103) place CPn0271 in the Abhydrolase_2 family which is described as Phospholipase/Carboxylesterase (PF02230)

PDB Hit:


Gene Protein Sequence:
MTDYSFFRRKIGNIEAIECPGNPQDPIIILCHGYGSLADNLTFFPSICSF
SKLRPTWIFPNGILPLENDFRGSRACFPLNVLLLQELSRLYANGVGNLQE
KYDELFDVDLETPKEALEELILNLNRPYNEIIIGGFSQGAILATHLVLTS
QNPYAGALIFAGARLFNQGWEEGLKQCAQVPFLQSHGYEDEILPYHLGAH
LNDLLLTKLNGQFVSFHGGHEIPSVVFQKMQVTVPNWIDPARG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGACTACTCTTTCTTTCGTCGCAAAATTGGCAATATTGAAGCCAT
AGAGTGCCCTGGAAATCCTCAAGATCCTATCATTATTCTGTGTCATGGTT
ACGGATCACTTGCTGATAATCTCACCTTCTTTCCTTCGATATGTTCCTTT
TCAAAATTACGCCCCACATGGATTTTTCCAAATGGAATCCTTCCCTTGGA
GAATGACTTCCGAGGCTCTCGTGCATGCTTTCCTCTTAATGTTCTTTTAT
TACAAGAACTCTCTAGGCTCTATGCCAATGGAGTAGGGAACCTTCAAGAA
AAATATGATGAACTATTTGATGTAGATCTAGAGACACCGAAAGAAGCTTT
GGAAGAACTTATCCTCAATCTCAATCGACCCTATAATGAAATTATCATTG
GTGGATTTAGTCAAGGAGCCATCCTGGCTACCCACCTTGTCTTAACTTCT
CAGAATCCTTATGCTGGAGCCTTAATCTTTGCTGGCGCAAGACTGTTCAA
TCAAGGCTGGGAAGAAGGACTTAAACAATGTGCTCAAGTGCCATTTTTAC
AAAGCCACGGTTATGAAGACGAAATTCTTCCTTATCACTTAGGAGCACAC
CTTAATGATCTTCTATTAACAAAGTTGAACGGGCAATTTGTTTCTTTCCA
TGGAGGACATGAAATTCCCTCTGTAGTATTCCAAAAAATGCAAGTTACAG
TTCCTAATTGGATAGATCCTGCCCGGGGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy