Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR225 IGR223 IGR221 IGR222 IGR220 IGR224 IGR219 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 tdk, - CPn0273 tdk, - CPn0273 CPn0266 CPn0271 CPn0267 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0270

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ywlC  

Definition:
conserved hypothetical protein (possible SuA5 family protein)

Gene Start:
303325

Gene Stop:
302465

Gene Length:
861

Molecular Weight*:
32036

pI*:
6.70

Net Charge*:
-1.77

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible SUA5-related protein (ywlC).

Blast Summary:  PSI-Blast Search
CPn0270 is orthologously related to CT137: residues 14-284 of CPn0270 are 42% similar to residues 5-275 of CT137, a predicted conserved hypothetical protein (possible SuA5 family protein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0009
COG name: Putative translation factor (SUA5)
Functional Class:  J
The phylogenetic pattern of COG0009 is amtkyqvCEbrH----olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 17 to 184 (E-value = 9.9e-19) place CPn0270 in the Sua5_yciO_yrdC family which is described as yrdC domain (PF01300)

PDB Hit:


Gene Protein Sequence:
VPDKKAQITFSLPEVMSAIHQGKIVALPTDTVYGFVLSLYASEAEERLYA
LKDREPSKAFALYVNSIEDIENISGYPLSPTAKKLAQLFPGAITLVVKHR
NPRFPKETLAFRIVDHSVVREIVDHCGTLIGTSANLSEFPSALTAQEIFA
DFADHDLCIFDGPCSHGLESTVVASDPLYIYREGLISRSVIENIAGTEAK
IFHRTSHAFSKHIKIYTVKNQEQLVSFLSGSLDFKGVVCEHPKPKNFYTR
LREALKKKTPSIVFIYDINTSDYPELFPFLSPYYIE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCTGATAAAAAAGCACAGATTACTTTTTCGCTTCCAGAGGTTATGTC
AGCTATACATCAAGGGAAAATTGTCGCTCTTCCTACTGACACTGTCTATG
GGTTTGTTCTTAGCTTGTATGCCTCTGAAGCTGAAGAAAGACTCTATGCT
TTAAAAGATAGAGAACCTAGTAAAGCTTTTGCCCTTTATGTAAATTCTAT
TGAAGATATTGAAAACATTTCTGGTTATCCCTTATCTCCTACAGCTAAGA
AATTAGCTCAACTTTTCCCAGGAGCAATTACTTTAGTAGTTAAGCACCGC
AATCCTAGATTCCCTAAAGAAACACTAGCGTTTCGCATTGTAGATCACTC
TGTAGTTCGGGAAATTGTGGATCACTGTGGAACCTTAATCGGAACATCTG
CGAATCTTTCAGAGTTTCCTTCAGCTCTTACAGCTCAAGAGATATTCGCA
GACTTTGCTGATCATGATCTCTGTATTTTTGATGGCCCTTGTTCCCATGG
TTTAGAGTCCACAGTAGTTGCCTCAGATCCTCTTTATATTTATCGTGAGG
GGCTGATTTCTCGCAGTGTTATAGAAAACATTGCAGGGACTGAAGCTAAG
ATTTTTCATAGAACGTCACATGCCTTTTCGAAGCATATCAAGATCTATAC
AGTGAAAAATCAAGAGCAATTAGTATCTTTTTTGAGCGGATCTTTAGATT
TTAAAGGTGTGGTTTGTGAACATCCTAAACCTAAGAATTTTTATACCAGA
TTACGGGAAGCTTTAAAAAAGAAAACTCCTTCTATAGTCTTTATTTATGA
TATAAATACATCGGATTATCCCGAACTTTTCCCCTTTCTTTCCCCTTATT
ATATTGAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy