Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR225 IGR218 IGR223 IGR221 IGR222 IGR220 IGR224 IGR219 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 ubiX, - CPn0264 tdk, - CPn0273 ubiX, - CPn0264 tdk, - CPn0273 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0269

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable dipeptidase)

Gene Start:
302450

Gene Stop:
301473

Gene Length:
978

Molecular Weight*:
35927

pI*:
6.40

Net Charge*:
-4.19

EC:
3.4.13.19  

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0269 is orthologously related to CT138: residues 1-315 of CPn0269 are 54% similar to residues 1-306 of CT138, a conserved hypothetical protein, probable dipeptidase, from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MTIDMHCDLLSHPHFCRKDPAVRCSPEQLLSGGVRQQVCAIFVPHSRGEP
NCDKQNSLFFSLPNQYPDIGLLSYEEEENGSSSQKKSLSLIRSIENASAL
GDDTAPLGTLLAKLIHLTKQGPLAYLGIVWKGDNRFGGGTEAPKRLSNDG
KVLLDIMYELGVPIDLSHCSDKLAEDILDYTADKLPNLAVIASHSNFRSV
LDHRRNLVDAHAKEIVRRKGVIGLNLVRSYVGDSLGDLEKHVLHAENLGI
LSSIVLGSDFFYANEDENFFFNECSSAEAHPVLNQLIHRIFSKGKAESIL
SSRAEKFLKQVIVEQVNPKITDVKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTATCGATATGCATTGTGACTTACTTTCGCATCCGCATTTTTGTCG
GAAAGATCCTGCGGTGAGGTGTTCTCCAGAACAACTCCTATCTGGAGGCG
TACGTCAGCAGGTGTGTGCTATTTTTGTCCCCCACAGTCGGGGGGAACCT
AATTGTGATAAACAAAACTCTCTGTTTTTTTCTCTTCCTAACCAATATCC
GGATATTGGGTTATTATCTTATGAAGAAGAAGAGAACGGATCCTCTTCTC
AAAAAAAATCACTAAGTCTTATTCGTAGTATAGAAAATGCCTCAGCTTTG
GGAGATGATACCGCCCCCCTTGGGACTCTATTAGCAAAGCTTATACATTT
AACTAAACAGGGGCCTCTTGCCTATCTAGGAATCGTATGGAAAGGGGATA
ACCGTTTTGGAGGCGGCACAGAAGCTCCTAAGAGACTTTCTAATGATGGT
AAGGTTCTTTTAGATATCATGTACGAACTTGGAGTTCCAATAGATCTTAG
CCATTGTAGTGATAAGTTAGCTGAAGATATTTTAGATTATACTGCCGATA
AATTGCCCAATCTCGCAGTGATTGCCAGTCATTCTAATTTTCGATCTGTT
CTTGATCATCGAAGGAACCTTGTAGATGCCCATGCCAAGGAGATTGTGAG
AAGAAAAGGTGTTATTGGTTTGAATCTAGTGAGGTCTTATGTAGGAGATT
CCTTGGGTGATTTGGAGAAGCATGTCCTCCATGCGGAGAATCTCGGAATT
TTATCAAGTATTGTTCTTGGGTCGGATTTCTTTTATGCAAATGAAGACGA
AAATTTCTTTTTTAATGAGTGTAGTTCTGCGGAAGCCCATCCCGTTCTAA
ATCAGTTGATTCATCGTATTTTTTCTAAAGGGAAAGCAGAGTCCATACTT
TCTTCTCGGGCTGAGAAATTTTTAAAGCAAGTCATTGTAGAACAAGTGAA
TCCAAAGATAACAGACGTGAAATTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy