Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Asp_1 IGR225 IGR218 IGR223 IGR221 IGR222 IGR220 IGR224 IGR217 IGR219 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 gyrA, - CPn0274 CPn0268 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 ubiX, - CPn0264 tdk, - CPn0273 ubiX, - CPn0264 tdk, - CPn0273 gyrA, - CPn0274 CPn0266 CPn0271 CPn0267 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0268

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
300935

Gene Stop:
301321

Gene Length:
387

Molecular Weight*:
13932

pI*:
3.60

Net Charge*:
-16.04

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several weak (insignificant?) hits to a GAG sequence; e.g. residues 5-106 are 34% similar to gag-kit polyprotein precursor - feline sarcoma virus; residues 5-106 are 33% similar to (M18247) gag-pol precursor polyprotein gPr80 [Feline leukemia virus]; and residues 5-106 are 34% similar to GAG_FSVHZ.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 14-68 are 44% similar to a defined domain of GAG_FSVMD.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
50  
128

PDB Hit:


Gene Protein Sequence:
MSQCQSSSTSTWEWMKSFVPNWKNPTPPLSPIPSEDEFILAYEPFVLPKT
DPENAQANPPGTSTPNVENGIDDLNPLLGQPNEQNNANNPGTSGSNPTSL
PAPERLPETEENSQEEEQGSQNNEDLIG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCAATGTCAGAGTAGCAGTACATCTACCTGGGAATGGATGAAATC
TTTTGTGCCAAACTGGAAGAATCCAACTCCCCCCTTATCTCCTATACCTT
CTGAGGACGAATTTATATTAGCATACGAGCCATTTGTTCTACCGAAAACA
GATCCAGAAAACGCACAAGCTAATCCTCCAGGCACATCTACACCGAATGT
AGAAAACGGGATCGATGATCTCAACCCTCTTCTGGGGCAACCCAACGAAC
AAAACAATGCCAACAATCCAGGAACTTCTGGATCTAATCCTACATCTCTA
CCCGCCCCCGAACGACTCCCTGAAACTGAAGAGAACAGCCAAGAAGAAGA
ACAAGGATCTCAAAATAATGAGGATCTTATAGGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy