Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Asp_1 IGR218 IGR223 IGR221 IGR222 IGR220 IGR224 IGR217 IGR219 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 CPn0268 CPn0266 CPn0271 CPn0267 surE, - CPn0262 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 CPn0268 CPn0266 CPn0271 CPn0267 surE, - CPn0262 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 ubiX, - CPn0264 tdk, - CPn0273 ubiX, - CPn0264 tdk, - CPn0273 CPn0266 CPn0271 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0267

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
300122

Gene Stop:
300913

Gene Length:
792

Molecular Weight*:
28683

pI*:
8.20

Net Charge*:
4.10

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarity to a known sequence in any other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0267 is similar to CPn0266 and CPn0011, both hypothetical proteins. Residues 4-215 are 46% similar to CPn0266 and residues 30-97 are 41% similar to CPn0011.

Pfam Summary:  Pfam Search
Residues 12 to 230 (E-value = 9.3e-89) place CPn0267 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
43  
64
transmembrane  
69  
93
transmembrane  
160  
183
transmembrane  
188  
206
transmembrane  
211  
228

PDB Hit:


Gene Protein Sequence:
VSIMSLNKTNALLNQPEPAVCLNAWDPKYINQDRKTFACTVTLLVIATLM
ILTTGVIVLLAMGSPGLSVLVSTIIGTSVTTLGTALFIIGLVKLIKKSLA
WIQYQKYFQEVVKQKYEPFSIPKNDNVHKLTSCLPSPLDIESPSPEASTP
VSKLRIACSGVAIVLGVTLLIGAVVSVFFCTGYLQLALCVGFACLGTALF
VGGLAGLRTHSLIAQGIMYLYLTYYLSSALEERNETVKDQRNEINTYLTE
ECRQQKREKALLE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCAATAATGTCATTGAATAAAACCAATGCCCTTCTCAATCAACCAGA
GCCTGCTGTTTGCCTTAATGCTTGGGACCCTAAATATATCAACCAAGATC
GAAAAACTTTCGCATGCACTGTTACCCTACTTGTTATAGCAACTCTGATG
ATCCTAACAACAGGAGTTATCGTATTACTTGCTATGGGCTCTCCTGGATT
AAGCGTTCTTGTATCAACAATTATAGGAACCTCTGTAACAACTTTAGGGA
CTGCTCTCTTCATAATTGGTTTAGTTAAACTAATTAAAAAATCATTAGCA
TGGATACAGTATCAGAAATACTTTCAAGAAGTCGTAAAACAGAAATATGA
ACCCTTTAGCATTCCTAAAAATGATAACGTACACAAACTCACTTCGTGCT
TACCATCACCTTTAGATATTGAGAGTCCGTCTCCAGAAGCAAGTACCCCA
GTCTCTAAGTTACGCATTGCATGTTCAGGAGTCGCTATTGTTTTAGGAGT
GACTCTTCTTATTGGTGCTGTCGTCTCCGTATTTTTCTGCACTGGATACC
TACAACTAGCTCTATGTGTAGGATTCGCTTGTCTTGGAACTGCCCTCTTT
GTTGGGGGATTGGCAGGGTTGCGGACCCACAGCTTAATCGCTCAGGGCAT
CATGTATCTTTACCTGACTTACTATCTATCATCGGCTCTGGAAGAAAGAA
ACGAAACAGTCAAGGATCAGCGTAACGAAATCAATACATATTTAACCGAG
GAATGCAGGCAGCAAAAAAGGGAAAAGGCGCTGTTGGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy