Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Asp_1 IGR218 IGR223 IGR221 IGR216 IGR222 IGR220 IGR224 IGR217 IGR219 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 CPn0268 CPn0266 CPn0271 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 CPn0268 CPn0266 CPn0271 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 ywlC, - CPn0270 ubiA, - CPn0265 dnaX,dnaZ, - CPn0272 CPn0269 ubiX, - CPn0264 ubiX, - CPn0264 CPn0266 CPn0271 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0266

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
299184

Gene Stop:
299879

Gene Length:
696

Molecular Weight*:
24229

pI*:
9.30

Net Charge*:
3.85

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18415.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical proteins in C.pneumoniae; e.g. residues 1-183 are 46% similar to residues 4-215 of CPn0267; residues 26-98 are 40% similar to residues 22-94 of CPn0011; and residues 12-92 are 35% similar to residues 12-85 of CPn1054.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
39  
60
transmembrane  
67  
86
transmembrane  
129  
149
transmembrane  
154  
171

PDB Hit:


Gene Protein Sequence:
MALDEINNQNNPSQQIASSTSQTSKINQDRKTFACTVTLLVVATLMILSG
IVLLFTIGSLGLSVPLSGILGTFAVTVGAVLFITGLTILVRKSLGIEQKN
EDLNFLKIKTPTPPARPLMSKFSVTCSTTSIVLGMALLIGAVVSVFFLTG
YLQLGLCAGLVGLGTALFVAGLARMSPRSLADQEGSGSADSQSNIVGIGE
PKAAQEQKWYKMAVVRGEDGIPTAIRLTPEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGTTAGATGAAATTAATAATCAGAACAACCCATCGCAACAGATAGC
CTCCTCGACTTCTCAAACTTCTAAAATCAACCAAGATCGAAAAACTTTCG
CATGCACTGTTACCCTACTTGTTGTAGCAACTTTGATGATCCTATCCGGG
ATTGTTTTGCTATTTACTATAGGTTCCCTAGGACTCAGCGTTCCTTTATC
TGGAATTCTAGGGACTTTTGCAGTGACAGTAGGAGCTGTTCTCTTTATCA
CAGGTCTAACTATTCTAGTTAGAAAATCCCTAGGAATCGAACAGAAAAAC
GAAGACTTGAATTTTTTAAAGATTAAGACCCCAACTCCCCCAGCACGCCC
CCTAATGTCAAAGTTTAGTGTTACCTGCTCCACTACAAGTATTGTTTTAG
GAATGGCTCTTCTTATCGGTGCTGTCGTCTCCGTATTTTTTCTCACAGGA
TATCTACAACTAGGCTTGTGTGCAGGACTTGTAGGTCTTGGAACCGCCCT
ATTTGTTGCAGGATTAGCAAGGATGTCCCCTCGTAGCCTAGCAGACCAAG
AAGGCTCCGGCTCCGCCGATTCTCAATCAAATATTGTTGGAATAGGTGAG
CCAAAAGCAGCTCAGGAACAAAAATGGTATAAAATGGCAGTGGTAAGGGG
AGAAGATGGTATACCAACAGCAATTCGCCTAACACCAGAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy