Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR223 IGR221 IGR216 IGR222 IGR220 IGR215 IGR217 IGR219 IGR214 CPn0260 ywlC, - CPn0270 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 ywlC, - CPn0270 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 ywlC, - CPn0270 ubiA, - CPn0265 CPn0269 ubiX, - CPn0264 ubiX, - CPn0264 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0265

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiA  

Definition:
benzoate octaphenyltransferase

Gene Start:
298620

Gene Stop:
297727

Gene Length:
894

Molecular Weight*:
33665

pI*:
9.80

Net Charge*:
9.19

EC:
2.5.1.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Biosynthesis and degradation of glycoprotein
Ubiquinone biosynthesis

Comment:
The UBIA enzyme catalyzes the prenylation of para-hydroxybenzoate, a
necessary step in the biosynthesis of coenzyme Q (ubiquinone). The ubiA and
ubiX genes are apposed, as in B. firmus. Note the abundance of predicted
transmembrane domains.

Blast Summary:  PSI-Blast Search
CPn0265 is similar to CT219, ubiA 4-hydroxybenzoate octaprenyltransferase.
Residues 9-292 are 42% similar to CT219. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0382
COG name: 4-hydroxybenzoate octaprenyltranferase
Functional Class: H
The phylogenetic pattern of COG0382 is AmTkyq-Ce---uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 19 to 293 (E-value = 1.4e-72) place CPn0265 in the UbiA family which is described as UbiA prenyltransferase family (PF01040)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
29
transmembrane  
47  
64
transmembrane  
91  
115
transmembrane  
120  
137
transmembrane  
142  
159
transmembrane  
167  
184
transmembrane  
220  
237
transmembrane  
242  
259
transmembrane  
276  
293

PDB Hit:


Gene Protein Sequence:
VRLNYFLNLVNFKYSIFSILFLSASTVFALSINEISQNLSFKEGFKISVF
GAIAFVFARTTGIVVNQCIDRFIDKKNTRTSKRVLPANLVSLNFAWVLSL
FCSFLFLFLCKILRIFSLGIASLTLMIVYPYMKRVTFFCHWGLGLVYTVA
ILMNFCAFAESGLSMRLCFLALLWGGSVGMVIAANDIIYAIEDTEFDREE
GLRSVPAHYGEKKAVEIAKVNLWVSYLAYIFSGFVGSLDKEFYFTAIIPL
VVILKVVRMYSNYSKKDQEGESKFFLANIAIALSFLVSMTLFWSLSR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGATTAAATTATTTTTTAAATTTAGTTAATTTTAAGTATTCAATATT
TTCAATACTTTTTTTATCAGCATCCACAGTCTTTGCTCTTTCTATAAATG
AGATTTCCCAAAATTTATCATTTAAAGAAGGGTTCAAGATTTCAGTTTTT
GGAGCCATAGCCTTTGTTTTTGCAAGGACTACGGGAATTGTAGTGAATCA
GTGTATCGACCGGTTCATTGATAAAAAAAATACAAGAACATCGAAAAGAG
TCCTTCCTGCGAATCTTGTTTCTTTAAATTTTGCTTGGGTACTCTCTCTA
TTTTGTAGTTTTCTTTTTCTTTTTCTCTGCAAGATTCTCCGTATTTTTAG
TTTGGGCATCGCTTCACTGACTCTTATGATCGTCTATCCCTATATGAAAA
GGGTGACTTTTTTCTGCCATTGGGGATTAGGGTTGGTGTACACTGTAGCG
ATTCTTATGAATTTTTGTGCTTTTGCTGAGTCGGGGCTTTCCATGCGTTT
ATGCTTTCTTGCTCTTTTATGGGGAGGGAGTGTGGGTATGGTAATAGCTG
CAAATGATATCATATATGCAATTGAAGATACCGAATTTGATAGGGAAGAA
GGATTGCGTAGTGTTCCTGCACATTACGGTGAAAAGAAAGCCGTTGAAAT
TGCAAAAGTAAACTTATGGGTAAGTTATCTTGCTTATATTTTTTCAGGTT
TTGTTGGTTCTTTAGATAAAGAGTTCTATTTCACAGCTATCATTCCTCTA
GTTGTGATTCTTAAGGTAGTTAGAATGTATTCTAACTACAGTAAAAAAGA
TCAAGAAGGAGAGAGCAAATTCTTTTTAGCGAATATTGCGATTGCTCTAT
CGTTTCTTGTAAGTATGACTTTGTTTTGGAGTTTGAGTAGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy