Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR221 IGR216 IGR222 IGR220 IGR215 IGR217 IGR219 IGR214 CPn0260 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 ubiA, - CPn0265 CPn0269 ubiX, - CPn0264 ubiX, - CPn0264 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0264

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ubiX  

Definition:
phenylacrylic acid decarboxylase (PAD)

Gene Start:
297730

Gene Stop:
297152

Gene Length:
579

Molecular Weight*:
21151

pI*:
7.00

Net Charge*:
0.06

EC:
4.1.1.-  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; menaquinone and ubiquinone  

Pathway: pathway table
Alkaloid biosynthesis I
Aminophosphonate metabolism
Arginine and proline metabolism
Ascorbate and aldarate metabolism
Flavonoids, stilbene and lignin biosynthesis
Phenylalanine metabolism
Purine metabolism
Pyruvate metabolism
Tryptophan metabolism
Tyrosine metabolism
Ubiquinone biosynthesis
Vitamin B6 metabolism

Comment:
This enzyme, part of the coQ (ubiquinone) pathway is said to confer
resistance to cinnamic acid in yeast(Clausen et al., Gene 142:107,1994). The ubiX gene
is also denoted dedF. In C.trachomatis, as in B. firmus, the ubiA and ubiX
genes are adjacent.

Blast Summary:  PSI-Blast Search
CPn0264 is orthologusly related to CT220, a predicted phenylacrylic acid decarboxylase (PAD):
residues 1-191 are 64% similar to CT220. No siilarity to T.pallidum, M.genitalium or
U.urealyticum.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0163
COG name: 3-octaprenyl-4-hydroxybenzoate decarboxylase
Functional Class:  H
The phylogenetic pattern of COG0163 is amtkyq-ceb--uj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 127 (E-value = 4.1e-54) place CPn0264 in the Flavoprotein family which is described as Flavoprotein (PF02441)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
86  
103

PDB Hit:


Gene Protein Sequence:
MKRYVVGISGASGVILAVKLIKELVNAKHQVEVIISPSGRKTLYYELGCQ
SFDALFSEENLEYIHTHSIQAIESSLASGSCPVEATIIIPCSMTTVAAIS
IGLADNLLRRVADVALKERRPLILVPRETPLHTIHLENLLKLSKSGATIF
PPMPMWYFKPQSVEDLENALVGKILAYLNIPSDLTKQWSNPE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCGTTATGTTGTGGGCATTTCAGGTGCCTCTGGGGTAATACTAGC
TGTTAAGCTTATTAAGGAACTCGTAAATGCAAAACATCAAGTTGAAGTAA
TTATTTCTCCTTCAGGAAGAAAGACGTTGTATTATGAACTAGGGTGTCAG
TCTTTTGACGCATTATTTTCAGAAGAAAACTTAGAGTATATTCATACTCA
TAGCATTCAAGCTATAGAGAGCTCTTTAGCGTCAGGATCTTGTCCTGTAG
AAGCTACGATCATTATTCCTTGCAGTATGACTACAGTTGCAGCTATTTCC
ATAGGTTTAGCAGATAATTTACTGCGACGTGTTGCTGATGTGGCTCTTAA
AGAAAGGCGACCCTTGATTCTTGTCCCTAGAGAGACCCCTTTGCATACGA
TCCATTTAGAAAATCTCTTAAAATTAAGCAAGAGTGGGGCAACGATTTTT
CCGCCGATGCCTATGTGGTACTTTAAGCCTCAATCGGTTGAAGATCTTGA
AAATGCTTTAGTAGGAAAAATCCTTGCTTATCTAAATATCCCTAGCGACC
TAACGAAACAATGGTCGAATCCAGAGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy