Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR221 IGR216 IGR222 IGR220 IGR215 IGR217 IGR219 IGR214 CPn0260 CPn0257 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0257 ubiA, - CPn0265 CPn0269 CPn0268 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0257 ubiA, - CPn0265 CPn0269 ubiX, - CPn0264 ubiX, - CPn0264 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0268
* Calculated from Protein Sequence

Gene ID: CPn0263

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yqfU  

Definition:
conserved hypothetical protein (related to YqfU-BACSU)

Gene Start:
296249

Gene Stop:
297139

Gene Length:
891

Molecular Weight*:
32576

pI*:
8.50

Net Charge*:
4.97

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Appears to be an integral membrane protein in Bacillus. CT221 has six
potential transmembrane regions that correspond closely to six potential regions in YQFU_BACSU
(yqfU).

Blast Summary:  PSI-Blast Search
CPn0263 is orthologously related to CT221: residues 1-296 of CPn0263 are 80% similar to residues 1-296 of CT221, a predicted conserved hypothetical protein (related to YQFU-BACSU) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1284
COG name: Uncharacterized BCR, YitT family
Functional Class:  S
The phylogenetic pattern of COG1284 is ------v--B----GPo-in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 19 to 102 (E-value = 7.2e-19) place CPn0263 in the DUF161 family which is described as Uncharacterized BCR, YitT family COG1284 (PF02588)
Residues 123 to 205 (E-value = 9.9e-23) place CPn0263 in the DUF161 family which is described as Uncharacterized BCR, YitT family COG1284 (PF02588)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
38
transmembrane  
50  
74
transmembrane  
85  
103
transmembrane  
125  
142
transmembrane  
167  
188
transmembrane  
193  
210

PDB Hit:


Gene Protein Sequence:
MSHGPRPTKFSFPLYFSKTLSWFILGGFLAACGVQMVLVPNELIDGGIVG
LSIIASHFLGHKALPFCLVLFNLPFVFLAFKQIGKYFVIQMLTAVIIFSC
SLWLIDQLPSWLGMSPFVFKGSEMETVVLGGAIIGVGCGLIIRHGGSTDG
TEILGIIINKKKGYTVGQIILFVNFFIFALSGIVYKNWHTAFVSFLTYGI
ATKVMDMVILGLEDTKSVTIITSSPRKLGHILMETLGIGLTYIHAEGGYS
GEPRNLLYVVVERLQLSQLKEIVHREDPSAFIAIENLHEVINGRRT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCACGGTCCACGTCCAACAAAATTCAGTTTCCCTCTGTATTTCTC
CAAAACATTAAGTTGGTTTATTTTAGGTGGCTTTCTTGCTGCTTGCGGAG
TTCAGATGGTATTAGTGCCTAATGAACTTATCGATGGTGGTATTGTTGGC
CTCTCCATTATAGCCTCGCATTTTTTAGGTCACAAAGCCCTTCCTTTTTG
CTTAGTTCTCTTCAATCTTCCTTTTGTATTCCTAGCATTTAAGCAAATTG
GGAAATACTTTGTGATTCAAATGTTGACAGCCGTGATTATTTTTTCGTGT
TCTCTCTGGCTTATTGATCAACTCCCCTCTTGGCTCGGCATGAGCCCCTT
TGTTTTTAAAGGATCAGAAATGGAAACCGTTGTGCTAGGCGGTGCTATTA
TTGGCGTGGGTTGTGGATTGATTATCCGCCACGGAGGGTCTACAGATGGC
ACAGAGATTCTAGGAATCATTATCAATAAAAAGAAAGGCTACACTGTTGG
CCAAATCATTTTATTTGTAAACTTCTTTATCTTTGCTTTATCTGGTATTG
TCTACAAAAATTGGCACACTGCTTTCGTTTCATTTCTAACCTATGGAATT
GCAACAAAAGTCATGGATATGGTGATTTTAGGCCTCGAAGATACGAAGTC
TGTCACTATTATTACCTCTTCTCCAAGAAAGCTAGGCCATATTCTCATGG
AAACCTTAGGGATTGGCTTAACCTATATTCATGCAGAAGGAGGATACTCC
GGAGAACCTAGAAACCTTCTTTATGTTGTTGTCGAACGTCTTCAACTTTC
ACAACTAAAAGAAATCGTTCATAGAGAAGATCCCTCAGCATTTATCGCCA
TTGAGAACCTCCATGAGGTAATCAATGGTAGACGAACTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy