Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR216 IGR220 IGR215 IGR217 IGR219 IGR214 CPn0260 CPn0257 CPn0256 ubiA, - CPn0265 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0257 CPn0256 ubiA, - CPn0265 CPn0266 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0257 CPn0256 ubiA, - CPn0265 ubiX, - CPn0264 ubiX, - CPn0264 ydaO, - CPn0261 CPn0267 surE, - CPn0262 yqfU, - CPn0263 CPn0266
* Calculated from Protein Sequence

Gene ID: CPn0262

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
surE  

Definition:
SURE-related acid phosphatase

Gene Start:
295091

Gene Stop:
295936

Gene Length:
846

Molecular Weight*:
30446

pI*:
4.80

Net Charge*:
-7.61

EC:
 

Functional Class:
cellular processes; adaptations to atypical conditions  
cellular processes; signal transduction  

Pathway: pathway table

Comment:
For the function of this putative survival/stress protein in E. coli, see Ichikawa et al., J. Bact. 176:6015, 1994.
See CT218.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to survival protein surE sequences; e.g. residues 9-245 are 31% similar to (AE000602) stationary-phase survival protein (surE) [Helicobacter pylori 26695]; residues 8-245 are 29% similar to SURE_ECOLI; residues 8-178 are 33% similar to (U81296) survival protein surE [Sinorhizobium meliloti]; residues 1-272 are 40% similar to CT218; and residues 8-138 are 37% similar to TP0419. No significant similarity to M.genitalium, M.pneumoniae, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0496
COG name: Survival protein SurE, predicted acid phosphatase
Functional Class: R
The phylogenetic pattern of COG0496 is amt-yqvCe--huj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 9-245 are 32% similar to a defined domain of O25584_XXXXX, defined as: PROTEIN SURE SURVIVAL HOMOLOG STATIONARY-PHASE STATIONARY PHASE SLL1459 ACID PHOSPHATASE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 203 (E-value = 4.6e-49) place CPn0262 in the SurE family which is described as Survival protein SurE (PF01975)

PDB Hit:


Gene Protein Sequence:
LVLMNKRLKIILTNDDGITAKGMSCLVSALLEANIGDIYIAAPQAEQSGK
SMAISLNQVVCASPYAYPQPVKEAWAVGGSPTDCVRLGLRTLFESVSPDL
VISGINCGNNICKNAWYSGTIGAAKQALVDGIPSMALSQDNHISFFQQDK
APEILKALVIYLLSQPFPCLTGLNINFPTSPGGSSWEGMRLVPPGDEFFY
EEPQYLGSVNKNQYYVGKISGVRIGEHPSEELACMLENHISVSPIFSQNS
PIGLMTLEEFQKTQENFNASLLSSELTTKIF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTTCTCATGAATAAAAGATTAAAGATAATTCTAACTAATGATGATGG
AATCACAGCTAAAGGAATGAGTTGCCTAGTCTCTGCTCTATTGGAAGCAA
ATATTGGTGATATTTATATTGCAGCTCCCCAAGCCGAACAGTCGGGGAAA
AGCATGGCAATCTCTCTGAACCAAGTAGTCTGCGCCTCTCCGTATGCATA
CCCGCAACCCGTTAAAGAAGCATGGGCAGTAGGAGGCTCTCCTACAGATT
GCGTTAGACTCGGCCTTAGAACACTTTTTGAATCGGTTTCCCCTGATTTA
GTGATTTCAGGAATTAACTGTGGGAACAACATATGCAAGAATGCTTGGTA
TTCAGGAACCATAGGCGCTGCAAAACAAGCCTTGGTCGATGGCATTCCAT
CGATGGCACTTTCTCAGGATAACCATATTTCTTTCTTTCAACAAGACAAG
GCTCCTGAAATTTTAAAAGCATTAGTGATTTATCTCTTGTCTCAACCCTT
TCCTTGTTTAACTGGGTTAAATATTAACTTTCCTACCAGTCCTGGGGGTT
CCTCTTGGGAAGGTATGCGACTTGTGCCTCCAGGAGATGAATTTTTTTAC
GAGGAACCTCAATACCTAGGCTCTGTAAACAAAAATCAATATTATGTAGG
GAAAATTTCTGGAGTACGGATTGGAGAGCATCCATCAGAAGAACTCGCTT
GCATGCTAGAAAACCATATCAGCGTGTCTCCTATATTTTCACAAAACTCT
CCTATCGGCTTAATGACTCTAGAGGAATTTCAAAAGACACAAGAAAATTT
CAATGCATCGCTTTTAAGCTCTGAGCTGACCACTAAAATTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy