Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR216 IGR213 IGR215 IGR217 IGR219 IGR214 CPn0260 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 CPn0266 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 CPn0266 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 ubiX, - CPn0264 ubiX, - CPn0264 CPn0266 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263
* Calculated from Protein Sequence

Gene ID: CPn0261

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ydaO  

Definition:
conserved hypothetical protein (probable PPloop ATPase member)

Gene Start:
294302

Gene Stop:
295036

Gene Length:
735

Molecular Weight*:
27184

pI*:
10.30

Net Charge*:
14.83

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0261 is orthologously related to CT217: residues 21-244 of CPn0261 are 70% similar to residues 1-224 of CT217, a predicted conserved hypothetical protein (probable PPloop ATPase member) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0037
COG name: Predicted ATPases of the PP-loop superamily
Functional Class:  R
The phylogenetic pattern of COG0037 is AMTKyQVcEbrHUJgpolINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 36 to 235 (E-value = 3.8e-12) place CPn0261 in the ATP_bind_3 family which is described as PP-loop family (PF01171)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
163  
181

PDB Hit:


Gene Protein Sequence:
MSTLLLNPPWMKAGKRIESLVRKALYTHTMLANHRKIVVALSGGKDSLTL
LLMLKAISGRGFPDLDLHAVNIGGKYSCGAEVNKPYLTRICDQLCIPFRT
IPSPYAPETPECYPCSQARRRLLFQAAKEIGASAIAFGHHRDDLVQTALL
NLLHKAEFAGMLPVLDMVHFGVTILRPLIFTPEFWIRKFAKENGFARVTC
RCPVVSLRSKAEQSLKLLEEVFPLARHNIALAIQEHGSSKSQKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCACTTTACTTTTAAATCCTCCGTGGATGAAAGCGGGAAAACGTAT
AGAAAGCTTGGTCCGAAAAGCACTCTATACCCATACCATGTTAGCAAATC
ATCGTAAAATTGTAGTTGCTCTCAGTGGTGGGAAAGATAGTCTTACACTT
CTTTTAATGCTCAAAGCAATTTCTGGAAGAGGATTCCCAGATTTAGATCT
CCACGCGGTCAATATCGGAGGAAAATACTCTTGTGGAGCAGAAGTTAATA
AACCTTATTTAACCCGCATCTGTGATCAACTGTGCATTCCGTTTAGAACA
ATTCCCTCTCCTTATGCACCCGAAACCCCAGAATGTTATCCATGCTCTCA
AGCAAGGAGACGTTTACTTTTCCAAGCCGCTAAAGAAATAGGAGCTTCGG
CTATCGCTTTTGGTCATCACCGAGATGACCTCGTCCAAACCGCCTTATTA
AATCTTCTACATAAAGCAGAGTTTGCTGGAATGCTTCCCGTTTTGGATAT
GGTCCATTTCGGAGTTACCATTTTGCGCCCCTTAATTTTCACTCCCGAAT
TCTGGATTCGCAAGTTCGCTAAGGAAAACGGCTTCGCAAGAGTCACTTGC
CGTTGTCCCGTGGTTTCATTAAGAAGCAAAGCGGAACAAAGTTTAAAGTT
ATTAGAAGAGGTATTCCCTTTAGCACGTCATAATATCGCTTTGGCAATTC
AAGAACATGGGTCATCCAAATCACAAAAAATTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy