Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR218 IGR216 IGR212 IGR213 IGR215 IGR217 IGR219 IGR214 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0260 CPn0255 CPn0257 CPn0256 ubiA, - CPn0265 ubiX, - CPn0264 ubiX, - CPn0264 CPn0254 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263
* Calculated from Protein Sequence

Gene ID: CPn0260

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (possible secA fragment)

Gene Start:
294045

Gene Stop:
293545

Gene Length:
501

Molecular Weight*:
18753

pI*:
7.60

Net Charge*:
1.20

EC:
 

Functional Class:
cellular processes; standard protein secretion  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0260 is similar to CT141, a predicted hypothetical protein. Residues 3-156 are 46% similar to CT141.
Numerous weak hits over first 30 residues to preprotein translocase secA subunit sequences; e.g. residues 3-22 are 75% similar to residues 877-896 of SECA_ECOLI; residues 2-25 are 66% similar to residues 832-855 of (AE001503) preprotein translocase subunit [Helicobacter pylori J99]; residues 5-25 are 66% similar to residues 832-855 of SECA_STACA; and residues 3-22 are 70% similar to residues 884-903 of (AB012226) SecA [Vibrio alginolyticus]. No significant similarity to T. pallidum, M. genitalium, U. urealyticum, or M. pneumoniae.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0653
COG name: Preprotein translocase subunit SecA (ATPase, RNA helicase)
Functional Class:  N
The phylogenetic pattern of COG0653 is -----qvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 7 to 27 (E-value = 1.5e-09) place CPn0260 in the SEC-C family which is described as SEC-C motif (PF02810)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
65  
136

PDB Hit:


Gene Protein Sequence:
VSKKINRNDLCPCGSNKKYKQCCLKKEEQTARYTTEGKFKFSAEVLSASE
QGEAGDNCTKLFQRLSQSLTSEQKAAVGKFHQITKNKEVMSKKALKKAQA
KEEKLVTEKLQQHNFEILNTGENLAPPMESTATLNQDTNFVCEDFIPTQE
DFRISENSQKPPVEED$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCAAAAAAAATTAATAGAAATGATTTATGCCCTTGTGGTTCTAATAA
AAAGTACAAGCAATGTTGTTTAAAAAAAGAAGAACAAACAGCTCGGTATA
CAACTGAAGGAAAATTTAAATTTTCTGCTGAAGTTCTCTCTGCATCCGAG
CAGGGAGAAGCAGGAGATAATTGTACGAAGTTGTTCCAGCGTTTATCTCA
ATCTTTAACTTCAGAACAGAAAGCGGCTGTTGGTAAGTTTCATCAGATTA
CTAAGAACAAAGAAGTAATGAGTAAAAAAGCTCTTAAGAAAGCTCAGGCA
AAAGAAGAGAAATTGGTTACAGAGAAACTTCAGCAGCATAATTTTGAGAT
TCTAAATACTGGAGAGAATCTAGCTCCACCTATGGAGAGTACAGCTACTT
TGAATCAAGACACTAATTTTGTTTGTGAGGATTTTATCCCTACACAAGAA
GATTTTCGCATATCTGAAAACTCTCAAAAACCTCCAGTTGAGGAAGATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy