Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Val_1 tRNA_Thr_2 tRNA_Asp_1 tRNA_Tyr_1 IGR216 IGR212 IGR213 IGR215 IGR217 IGR211 IGR214 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0251 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0251 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 ydaO, - CPn0261 surE, - CPn0262 yqfU, - CPn0263 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0257

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
292127

Gene Stop:
291264

Gene Length:
864

Molecular Weight*:
31756

pI*:
5.20

Net Charge*:
-4.51

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0257 is similar to CT143, a hypothetical protein: residues 13-287 are 34% similar to CT143.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0257 is paralogously related to CPn0253, a conserved hypothetical protein: residues 25-287 are 55% similar to CPn0253.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKRRNLQKILPNASTPSTNVAENTGIKDQNLFLDQATLNVDGNVDIENFL
ETRDLKVADTITSPCEFTVGGGLSAESSQFKATTLSKGLEITSEDQDGRV
PKFTNVSDPQSPRDALTYNYYRNTGCQALNLYTYYSSSQPTTVGKPIETV
CQNPNPETYRISASAKIYDAVTRFPYIQFKAPGIYQVTIQIRRESGQHSG
LDNPNLYLNLMIGNNKTLLCASDTRGYSGGHRTSIAVTGTFTLTEIVATP
PHDYPWLFLETTIGLDIKSMSTCVIWFPFQANFAEVD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAAGAAACCTACAAAAAATTCTACCTAATGCTTCTACTCCGTC
TACAAATGTAGCCGAAAATACTGGAATAAAAGATCAGAACTTATTTCTTG
ATCAAGCGACTCTTAATGTGGATGGCAATGTCGATATAGAAAACTTTTTA
GAGACTCGAGATTTAAAAGTTGCAGATACAATCACTTCTCCATGTGAATT
TACTGTCGGGGGCGGATTATCAGCAGAAAGTTCTCAATTTAAAGCGACAA
CACTTTCTAAAGGTTTGGAGATCACTTCTGAAGATCAGGATGGCCGAGTT
CCTAAGTTTACAAATGTTAGCGATCCCCAATCTCCAAGAGATGCTTTAAC
ATATAACTATTATAGGAACACTGGATGCCAGGCCCTTAATCTGTATACCT
ACTATAGTTCATCTCAGCCTACTACTGTAGGTAAACCAATCGAAACGGTG
TGTCAAAACCCGAATCCAGAGACGTATCGCATTAGCGCTTCAGCTAAAAT
TTATGATGCTGTAACGAGATTCCCCTATATTCAGTTCAAGGCACCTGGAA
TCTATCAAGTCACAATACAAATACGTCGCGAGAGCGGGCAACATAGTGGA
CTTGATAATCCTAATTTATATCTGAACTTAATGATTGGGAATAATAAGAC
GCTGCTTTGTGCTTCAGATACGAGAGGTTACTCAGGAGGACATAGGACTA
GTATTGCTGTAACAGGCACGTTTACTTTAACAGAAATTGTTGCTACCCCC
CCTCATGATTACCCTTGGTTATTCTTAGAAACTACTATTGGTTTAGATAT
TAAATCCATGTCAACATGTGTTATTTGGTTTCCATTTCAAGCTAATTTTG
CGGAGGTAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy