Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_2 tRNA_Tyr_1 IGR210 IGR209 IGR212 IGR213 IGR215 IGR211 IGR214 rl33, - CPn0250 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 ydaO, - CPn0261 CPn0251 rl33, - CPn0250 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 ydaO, - CPn0261 CPn0251 rl33, - CPn0250 CPn0260 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 ydaO, - CPn0261 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0255

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
290165

Gene Stop:
289326

Gene Length:
840

Molecular Weight*:
30351

pI*:
4.70

Net Charge*:
-4.24

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0255 is similar to CT142, a hypothetical protein: residues 8-289 are 34% similar to CT142.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKNNINNNECYFKLDSTVDGDLLAANLKTFDTQAQGISSTETFSVQGNAT
FKDQVSATGLTSGTTYNLNAQNFTSSQISIDFKNNRLSNCALPKEDCDPV
PANYVRSPEYFFCSKPLIGDFDFNSGESYLPLTGSEYTLYQSRNVNSIFR
FIGWKQSTRELTVGGNTAIQFLAAGTYIVSFTVGKRWGWNNGWGGAIYIN
NGLGQVQCESTIYSGGGYATIGTLGTSIYRASVDVAPNPNDPNASDRYRA
GIFYLSNGGSSAGIGNYSFSLLYYPDDRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACAATATTAATAATAATGAGTGCTATTTTAAATTAGACTCAAC
TGTAGATGGTGATTTGTTAGCAGCCAATCTCAAGACCTTTGATACACAGG
CCCAAGGAATCTCATCGACTGAAACATTTTCTGTTCAGGGGAATGCAACA
TTTAAAGATCAAGTTTCAGCAACTGGATTAACTTCAGGAACTACTTATAA
TTTAAATGCACAAAACTTTACTTCCTCCCAAATCTCTATAGATTTTAAAA
ATAATCGTCTGAGTAATTGTGCATTGCCAAAAGAAGACTGCGATCCGGTG
CCAGCGAATTATGTTCGTTCTCCCGAATATTTTTTCTGTTCCAAGCCTCT
GATCGGAGATTTTGATTTTAACTCAGGGGAATCTTATTTGCCTCTGACTG
GTTCGGAATATACTCTATATCAGTCACGTAATGTAAATAGTATATTTCGT
TTTATAGGATGGAAGCAAAGTACACGAGAATTAACTGTAGGGGGAAATAC
TGCGATACAATTTCTTGCAGCAGGAACCTATATCGTTTCATTTACTGTTG
GTAAACGGTGGGGATGGAATAATGGTTGGGGAGGAGCCATTTATATCAAT
AATGGTTTAGGACAAGTCCAATGTGAAAGCACGATTTATAGTGGTGGAGG
GTATGCAACAATAGGTACACTGGGGACCTCAATATATAGAGCCTCTGTAG
ATGTAGCTCCTAATCCTAATGATCCGAATGCTTCGGATCGCTATAGAGCG
GGTATTTTCTATCTCAGTAACGGTGGTTCTAGTGCAGGTATAGGGAATTA
CTCCTTTTCTCTTCTCTATTATCCGGACGATAGAGGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy