Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Thr_2 tRNA_Tyr_1 IGR210 IGR208 IGR209 IGR212 IGR213 IGR211 IGR214 rl33, - CPn0250 CPn0260 ycfV, - CPn0248 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 CPn0251 rl33, - CPn0250 CPn0260 ycfV, - CPn0248 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 CPn0251 rl33, - CPn0250 CPn0260 ycfV, - CPn0248 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0254

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
289262

Gene Stop:
288456

Gene Length:
807

Molecular Weight*:
29667

pI*:
4.80

Net Charge*:
-5.76

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0254 is similar to CT143, a conserved hypothetical protein: residues 5-268 are 36% similar to CT143.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0254 is paralogously related to CPn0257, a conserved hypothetical protein: residues 5-267 are 55% similar to CPn0254.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKTLGVKDQNLFIDQATLSVERNVRIENNLETRDLKVLDTTTSPCEFIVK
GNVSAEGSQLNATTLSDGFNIYSKTDVSQTPVCNNISDPQSARDALTFSY
YRKTGCQAANLYTYYPGNGYYVAPNTTIETHVAAITSKSVSRNATPDFSR
YADIEPVVKLKQVGIYQVTMQLTRWSGQHDGDNSATLILNFVSGNNKTLL
CTSDTRGGYSSDRTSVAVTAIFSVTELVSSPPYDYPWINLESTIWMNLMS
LSTCVIWFPFPSNFVEVD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACTCTGGGGGTCAAAGATCAGAATTTATTTATAGATCAAGCAAC
TCTCAGTGTCGAAAGGAATGTAAGAATAGAAAATAATTTAGAGACTCGGG
ATCTCAAAGTCTTAGATACCACGACTTCTCCATGTGAATTTATTGTGAAG
GGTAATGTGTCTGCGGAAGGTTCTCAACTTAATGCTACTACACTCTCTGA
CGGTTTTAATATCTATTCTAAGACAGACGTATCGCAAACTCCAGTATGCA
ATAATATTAGTGATCCTCAGTCTGCTCGAGATGCGCTTACATTTAGTTAT
TATAGAAAAACTGGATGTCAGGCTGCGAATCTCTATACGTATTATCCTGG
GAATGGTTATTACGTTGCCCCTAACACTACAATTGAAACTCATGTTGCAG
CTATCACCTCTAAAAGTGTGAGTCGTAACGCGACCCCTGACTTCAGCAGA
TATGCAGATATTGAGCCTGTGGTTAAACTCAAACAAGTCGGGATCTATCA
AGTCACTATGCAGCTCACACGGTGGAGCGGACAACATGACGGAGATAATT
CTGCCACTCTAATTCTTAATTTTGTCTCTGGAAATAATAAAACGTTGCTT
TGTACTTCAGATACTAGAGGAGGTTATTCGAGTGACCGTACGAGTGTCGC
TGTAACTGCAATCTTCAGTGTAACAGAGCTGGTTTCTAGTCCTCCTTATG
ACTATCCTTGGATTAACTTAGAGAGCACGATATGGATGAACCTTATGTCT
CTATCCACATGTGTCATTTGGTTTCCATTTCCATCTAATTTTGTGGAGGT
AGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy