Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR212 IGR213 IGR207 IGR211 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0257 CPn0256 CPn0249 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0256 CPn0249 CPn0257 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0251

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
286060

Gene Stop:
287562

Gene Length:
1503

Molecular Weight*:
56822

pI*:
7.60

Net Charge*:
3.27

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST of conserved hypothetical protein sequences; e.g. residues 49-484 are 38% similar to (AE000710) hypothetical protein [Aquifex aeolicus]; and residues 55-490 are 35% similar to Y082_SYNY3.

Search of the STD-Pro database reveals similarity to TP0754 and TP0269, both of which are conserved hypothetical proteins. No significant similarity to C.trachomatis, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0621
COG name: Fe-S oxidoreductases family 1
Functional Class:  C
The phylogenetic pattern of COG0621 is amtk-QVCEBrhUJ---L-NX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 67-280 are 41% similar to a defined domain of Y082_SYNY3.

Residues 285-424 are 44% similar to a defined domain of YLIG_ECOLI.

Paralogs:  Local Blast Search
Residues 47-429 are 27% similar to CPn0477, a predicted hypothetical protein.

Pfam Summary:  Pfam Search
Residues 49 to 146 (E-value = 2.7e-45) place CPn0251 in the UPF0004 family which is described as Uncharacterized protein family UPF0004 (PF00919)
Residues 190 to 364 (E-value = 6.6e-27) place CPn0251 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)

PDB Hit:


Gene Protein Sequence:
MSPFKKIVNRLLCYISFQKESRTLPIIIREPRMTTKSLGSFNSVISKNKI
HFISLGCSRNLVDSEVMLGILLKAGYESTNEIEDADYLILNTCAFLKSAR
DEAKDYLDHLIDVKKENAKIIVTGCMTSNHKDELKPWMSHIHYLLGSGDV
ENILSAIESRESGEKISAKSYIEMGEVPRQLSTPKHYAYLKVAEGCRKRC
AFCIIPSIKGKLRSKPLDQILKEFRILVNKSVKEIILIAQDLGDYGKDLS
TDRSSQLESLLHELLKEPGDYWLRMLYLYPDEVSDGIIDLMQSNPKLLPY
VDIPLQHINDRILKQMRRTTSREQILGFLEKLRAKVPQVYIRSSVIVGFP
GETQEEFQELADFIGEGWIDNLGIFLYSQEANTPAAELPDQIPEKVKESR
LKILSQIQKRNVDKHNQKLIGEKIEAVIDNYHPETNLLLTARFYGQAPEV
DPCIIVNEAKLVSHFGERCFIEITGTAGYDLVGRVVKKSQNQALLKTSKA
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTCCTTTTAAGAAAATAGTAAATCGCTTACTATGCTATATTTCTTT
TCAAAAAGAATCAAGAACTCTCCCAATCATTATTAGAGAACCTAGGATGA
CAACAAAAAGTTTAGGATCTTTCAATTCAGTTATTTCCAAAAATAAAATT
CATTTTATTAGTTTGGGATGCTCTCGGAACCTTGTAGATAGCGAAGTCAT
GCTAGGCATTCTTCTTAAGGCAGGTTACGAGTCTACTAATGAAATTGAAG
ATGCTGACTATTTAATTTTAAATACCTGTGCGTTTTTAAAAAGTGCTAGA
GATGAAGCTAAAGATTATCTAGACCATCTAATTGATGTAAAAAAAGAGAA
CGCTAAAATTATTGTAACTGGATGCATGACTTCCAACCACAAAGATGAGC
TTAAACCCTGGATGTCACACATCCATTACCTACTAGGTTCTGGGGATGTT
GAGAATATTCTTTCTGCTATTGAGTCTCGTGAATCTGGAGAAAAAATCTC
TGCAAAGAGTTACATTGAGATGGGAGAAGTTCCAAGACAGCTTTCCACAC
CAAAACACTATGCCTATTTAAAAGTTGCTGAGGGCTGTAGAAAACGTTGT
GCTTTTTGTATTATTCCTTCCATTAAAGGAAAGCTCCGCAGCAAACCTCT
GGATCAAATTCTTAAAGAATTCCGCATCCTTGTAAACAAGAGTGTGAAAG
AGATTATATTGATAGCTCAAGACCTAGGAGATTATGGAAAGGATCTCTCT
ACAGACCGCAGTTCGCAGCTAGAATCACTATTACATGAGTTACTGAAAGA
GCCTGGTGATTATTGGCTGCGGATGTTGTATTTATATCCTGATGAAGTGA
GTGATGGCATTATAGATCTTATGCAATCTAATCCCAAACTTCTTCCCTAT
GTAGATATTCCCTTACAGCACATTAACGACCGTATTTTAAAGCAAATGCG
AAGAACGACTTCTAGGGAGCAAATCCTAGGATTCCTAGAAAAATTACGTG
CCAAGGTTCCTCAGGTCTATATCCGTTCTTCTGTTATTGTGGGTTTCCCC
GGTGAAACTCAGGAAGAATTCCAGGAGTTAGCTGATTTTATTGGTGAGGG
TTGGATTGATAATCTCGGAATTTTCTTGTACTCTCAAGAAGCGAATACCC
CGGCAGCAGAACTCCCTGACCAGATACCAGAAAAAGTTAAAGAATCGAGG
TTGAAAATTCTATCTCAAATTCAGAAACGCAATGTGGATAAACATAATCA
GAAGCTCATTGGGGAAAAAATAGAAGCAGTTATTGATAACTATCATCCTG
AAACGAATCTTTTACTCACTGCAAGGTTCTATGGACAAGCTCCTGAAGTG
GACCCTTGTATTATTGTAAATGAGGCGAAGCTTGTTTCTCATTTTGGAGA
AAGATGCTTTATAGAAATCACAGGGACTGCTGGTTACGACCTTGTAGGGC
GTGTTGTAAAAAAATCTCAGAACCAAGCTTTGCTAAAAACTAGCAAAGCT
TAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy