Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR212 IGR204 IGR213 IGR207 IGR211 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0256 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0256 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0256 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0250

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl33  

Definition:
50S ribosomal protein L33

Gene Start:
286057

Gene Stop:
285899

Gene Length:
159

Molecular Weight*:
6338

pI*:
11.40

Net Charge*:
11.22

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
BLAST reveals no significant similarity to
M. genitalium, T. pallidum and U. urealyticum.

CPn0250 is orthologously related to CT150:
residue 1-52 are 90% similar to that of CT150.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0267
COG name: Ribosomal protein L33
Functional Class: J
The phylogenetic pattern of COG0267 is ----yqvceBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 52 (E-value = 6.7e-12) place CPn0250 in the Ribosomal_L33 family which is described as Ribosomal protein L33 (PF00471)

PDB Hit:


Gene Protein Sequence:
MASKNREIIKLKSSESSDMYWTVKNKRKTTGRLELKKYDRKLRRHVIFKE
AR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAGCAAGAATCGGGAGATTATTAAATTAAAAAGCTCGGAAAGTTC
TGATATGTACTGGACTGTAAAAAACAAAAGAAAAACAACAGGTCGACTAG
AACTCAAAAAATATGATAGAAAACTGCGTAGGCACGTAATTTTCAAAGAA
GCTAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy