Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR212 IGR204 IGR202 IGR207 IGR203 IGR211 rl33, - CPn0250 rs9, - CPn0246 CPn0243 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0255 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0249

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
285841

Gene Stop:
284330

Gene Length:
1512

Molecular Weight*:
56367

pI*:
6.60

Net Charge*:
-2.38

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0249 is weakly similar to TP0963, TP0582 and TP0580, all conserved hypothetical (integral membrane) proteins.

CPn0249 is orthologously related to CT151, a conserved hypothetical protein and they share 54% similarity.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0577
COG name: Predicted permease
Functional Class:  R
The phylogenetic pattern of COG0577 is AMt--QVcEBRHuj--OLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 304 to 496 (E-value = 2.5e-40) place CPn0249 in the FtsX family which is described as Predicted permease (PF02687)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
43
transmembrane  
363  
381
transmembrane  
414  
433
transmembrane  
469  
486

PDB Hit:


Gene Protein Sequence:
MKFEFSVALKYLIPGRGRLYSAIVSLFSVGIISLVVWLSIVFISVIHGLE
QRWIEDLSQLHSPITILPSDTYYSSYYYQIDKHSSLSNYTTKTLGEKIAS
PQVDPYDPESDYLLPETFPLKDCDLGGQQKDPVKMTLESLGPYLQSQHGK
VIEFEQGVGYLDIKTSLKLQKPQPRNLTHFLTYPSKLSYEDKVLPYDETD
YTSAELNPFNRSPSGWQQDFHHLEELYRGASIILPSTYKDSGYKVGDTGV
FSTYSIENEKETQYTVHVIGFYNPGLSPLGGRTVFIDPDLARSIRSQSEG
LGMSNGFHLFFPNTKRIVFVKKQIENILTSLGVDDYWEISSLHDYDYFQP
ILDQLQSDQVLFLFVCILILIVACSNIVTMSMLLVNNKKKEIGILKAMGT
SSRSLKIIFACCGAFSGACGVVIGTIFAIITLKNLQFIVKALNYLQGRET
FNTAFFGQNLPNSVHPQAIYFLGLGTLLLAAVSGALPARKVAKMHVSEIL
KAD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTCGAATTTTCAGTAGCTTTAAAGTATTTGATTCCAGGAAGGGG
AAGGCTATATTCAGCTATAGTCTCCCTATTTTCTGTGGGTATCATTTCTC
TTGTTGTCTGGCTTTCTATAGTTTTTATTTCAGTCATTCACGGTTTAGAA
CAAAGATGGATAGAGGATCTTTCCCAACTCCATTCTCCAATTACTATTCT
TCCCTCCGACACATATTATTCTTCGTACTACTATCAAATAGACAAACACT
CCAGTCTTTCTAACTACACTACGAAAACTTTAGGAGAAAAAATAGCTTCT
CCACAAGTCGACCCTTATGATCCTGAATCAGACTACCTTCTTCCGGAAAC
ATTTCCATTAAAAGACTGTGATCTAGGAGGGCAGCAAAAAGATCCTGTAA
AGATGACTCTAGAATCTTTAGGACCCTACCTTCAATCCCAACACGGGAAA
GTGATCGAATTTGAGCAGGGAGTGGGTTACCTCGATATCAAAACCTCTCT
AAAATTACAAAAACCTCAGCCTAGAAATCTCACGCATTTTTTAACGTATC
CCTCTAAGCTTTCCTATGAAGATAAGGTTTTACCCTACGATGAAACAGAC
TATACCTCTGCGGAATTGAATCCATTTAATAGAAGCCCCTCGGGATGGCA
ACAAGATTTCCATCATTTAGAAGAACTCTACCGAGGGGCTTCGATCATAC
TCCCTAGTACTTATAAAGACTCTGGTTATAAAGTAGGGGATACAGGAGTT
TTTAGTACCTACTCCATAGAGAATGAAAAAGAAACTCAATATACAGTTCA
TGTCATCGGATTTTATAATCCCGGGCTCTCTCCGTTAGGGGGAAGAACTG
TATTTATAGACCCAGATCTTGCTAGATCCATTCGTTCTCAATCCGAGGGC
TTGGGGATGAGTAACGGCTTCCATCTATTTTTCCCCAATACCAAACGCAT
TGTCTTTGTAAAAAAACAAATAGAAAATATTCTAACTTCCTTAGGTGTCG
ATGACTATTGGGAGATTTCTTCCCTACACGATTACGATTATTTCCAGCCT
ATCCTAGATCAACTTCAAAGTGATCAAGTTCTCTTTCTTTTTGTGTGCAT
ACTTATTCTTATTGTTGCTTGCTCCAACATCGTGACTATGTCGATGCTCC
TTGTAAATAATAAGAAAAAGGAAATAGGCATTCTTAAAGCTATGGGGACA
TCATCACGAAGTTTAAAGATCATCTTTGCTTGTTGTGGAGCATTTTCAGG
AGCTTGTGGAGTGGTTATAGGAACGATATTCGCTATAATTACATTAAAAA
ATTTACAATTCATTGTAAAAGCACTGAACTATTTACAGGGAAGAGAAACA
TTTAATACTGCTTTCTTTGGCCAGAATCTTCCCAATAGCGTTCACCCCCA
GGCTATTTATTTTCTAGGGTTAGGTACGCTACTTTTAGCCGCAGTTTCAG
GAGCCCTGCCTGCAAGAAAAGTCGCAAAAATGCATGTCTCAGAAATTTTA
AAAGCAGATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy