Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR204 IGR201 IGR202 IGR207 IGR203 IGR211 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0241 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0241 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 rl13, - CPn0247 ycfV, - CPn0248 CPn0254 CPn0241 CPn0249 CPn0242 adk, - CPn0244 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0248

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ycfV  

Definition:
ABC transporter ATPase

Gene Start:
284327

Gene Stop:
283647

Gene Length:
681

Molecular Weight*:
24799

pI*:
7.20

Net Charge*:
0.54

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 1-221 are 60% similar to CT152; residues 1-221 are 38% similar to TP0964; residues 19-221 are 38% similar to MG467; residues 3-221 are 41% similar to (D90747) Heterocyst maturation protein (devA) homolog [Escherichia coli]; and residues 4-221 are 39% similar to YBBA_HAEIN.

COGS Summary:  COGS Search
BeTs to 14 clades of COG1136
COG name: ABC-type (unclassified) transport system, ATPase component
Functional Class:  R
The phylogenetic pattern of COG1136 is AMt--QVCEBRHUJGPOLinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 39-50 and 145-176 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 1.4e-21.

ProDom Summary:  Protein Domain Search
Residues 144-187 are 70% similar to a defined domain of O05779_MYCTU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Residues 24-72 are 51% similar to a defined domain of O66733_AQUAE, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Numerous probable paralogs found, the most similar of which are: CPn0280, CPn0723, CPn0542, CPn0413, CPn0201, and CPn0191. Residues 2-219 are 33% similar to CPn0280.

Pfam Summary:  Pfam Search
Residues 34 to 219 (E-value = 2.8e-47) place CPn0248 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
90

PDB Hit:


Gene Protein Sequence:
MSLLIEAKNLSKTIQQQNQNISILTDVSLSLHAGETISITGASGNGKTTL
LHLLGTLDVPSSGSLRFFDKDLKNQDLANFRNQHIGFVFQNFYLLEDDTV
LKNVLMPALIARKNISKGSPVYTRALELLDLVNLEDKVRTRCSKLSGGEK
QRVAIARALINEPAILLADEPSGNLDEETSEQIHNLLLEQASALCGILIV
THNKHLASRCSREGVLSNGKLFFHNS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCTTACTTATAGAAGCTAAAAACCTTTCTAAAACTATCCAGCAACA
GAACCAAAATATTTCTATTTTGACCGATGTATCGTTATCACTGCATGCAG
GAGAAACTATATCGATTACAGGAGCCTCAGGTAATGGTAAAACCACGCTA
TTGCATCTCTTAGGAACTTTGGATGTTCCTTCTTCTGGAAGCTTACGCTT
TTTTGATAAGGATCTAAAAAACCAGGATCTTGCGAATTTTAGAAACCAGC
ATATCGGCTTTGTCTTCCAAAATTTTTATTTGCTAGAAGACGACACAGTA
TTAAAAAATGTCTTAATGCCAGCTCTAATTGCTCGAAAAAACATATCTAA
AGGATCTCCTGTATATACCAGGGCTCTAGAGCTCTTGGATTTAGTGAATC
TTGAAGACAAAGTACGGACTCGCTGCTCTAAATTATCAGGAGGGGAAAAA
CAGCGAGTCGCTATTGCTAGAGCGTTAATCAACGAACCGGCCATCCTTTT
GGCAGACGAGCCTTCGGGGAATCTCGATGAAGAGACTTCAGAACAGATTC
ATAACCTTCTGTTAGAACAAGCATCCGCATTATGTGGAATTCTTATTGTG
ACACATAATAAGCACCTCGCCTCTAGGTGTTCTAGGGAAGGAGTCTTATC
CAATGGCAAGCTATTTTTTCATAACTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy