Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR204 IGR201 IGR202 IGR207 IGR200 IGR203 IGR211 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0240 CPn0249 CPn0243 CPn0241 adk, - CPn0244 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0246

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rs9  

Definition:
30S ribosomal protein S9

Gene Start:
282952

Gene Stop:
282548

Gene Length:
405

Molecular Weight*:
15147

pI*:
11.20

Net Charge*:
16.18

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:


Blast Summary:  PSI-Blast Search
CPn0246 is orthologously related to CT126:
residues 6-134 are 78% similar to residues
2-129 of CT126.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0103
COG name: Ribosomal protein S9
Functional Class:  J
The phylogenetic pattern of COG0103 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 13 to 134 (E-value = 1.3e-45) place CPn0246 in the Ribosomal_S9 family which is described as Ribosomal protein S9/S16 (PF00380)

PDB Hit:


Gene Protein Sequence:
VAKSTIQESVATGRRKQAVSSVRLRPGSGKIDVNGKSFEDYFPLEIQRTT
ILSPLKKITEDQSQYDLIIRVSGGGIQGQVIATRLGLARALLKENEENRQ
DLKSCGFLTRDPRKKERKKYGHKKARKSFQFSKR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCAAAAAGTACAATACAAGAATCTGTAGCTACAGGTAGAAGAAAACA
GGCTGTCTCTAGCGTCCGTTTACGACCTGGAAGTGGTAAAATTGATGTAA
ACGGTAAGTCTTTTGAAGATTATTTTCCTTTGGAAATTCAAAGAACTACA
ATTCTTTCTCCTTTGAAAAAAATTACAGAAGACCAAAGTCAATACGATTT
AATTATTCGTGTGAGCGGTGGAGGGATTCAAGGGCAGGTAATTGCTACAA
GATTAGGCCTTGCACGAGCTCTCTTAAAAGAAAATGAAGAGAATAGACAA
GACCTAAAGAGTTGCGGGTTTCTTACTAGAGATCCTAGAAAGAAAGAACG
TAAAAAATACGGACATAAAAAAGCTCGTAAAAGCTTCCAATTCTCTAAGC
GTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy