Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR205 IGR209 IGR204 IGR201 IGR202 IGR207 IGR200 IGR203 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 CPn0243 adk, - CPn0244 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0245

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ydhO  

Definition:
P60-related protein

Gene Start:
281645

Gene Stop:
282502

Gene Length:
858

Molecular Weight*:
32515

pI*:
8.40

Net Charge*:
5.65

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0245 is orthologously related to CT127: residues 1-284 of CPn0245 are 43% similar to residues 1-282 of CT127, a predicted P60-related protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0791
COG name: Cell wall-associated hydrolases (invasion-associated proteins)
Functional Class:  M
The phylogenetic pattern of COG0791 is -------cEBRHuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 154 to 267 (E-value = 4.6e-06) place CPn0245 in the NLPC_P60 family which is described as NlpC/P60 family (PF00877)

PDB Hit:


Gene Protein Sequence:
MKHYLSFSPSADFFSKQGAIETQVLFGERVLVKGSTCYAYSQLFHNELLW
KPYPGHSFRSTLVPCTPEFHIHPNVSVVSVDAFLDPWGIPLPFGTLLHVN
SQNTVIFPKDILNHMNTIWGSGTPQCDPRHLRRLNYNFFAELLIKDADLL
LNFPYVWGGRSVHESLEKPGVDCSGFINILYQAQGYNVPRNAADQYADCH
WISSFENLPSGGLIFLYPKEEKRISHVMLKQDSSTLIHASGGGKKVEYFI
LEQDGKFLDSTYLFFRNNQRGRAFFGIPRKRKAFL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACACTACCTATCATTTTCTCCTTCTGCTGATTTTTTCTCTAAACA
GGGTGCTATTGAAACTCAAGTCCTTTTTGGAGAGCGCGTCTTAGTCAAAG
GGAGCACCTGCTATGCATATTCCCAATTATTCCACAATGAGCTGTTATGG
AAGCCCTATCCAGGTCATAGCTTTCGTTCTACCCTAGTCCCCTGCACTCC
TGAATTTCATATCCATCCAAATGTTTCTGTGGTTTCTGTGGATGCATTTT
TAGATCCTTGGGGGATCCCTCTTCCTTTTGGAACTTTACTCCATGTGAAT
TCTCAAAATACCGTTATTTTCCCTAAGGATATTCTCAATCATATGAACAC
CATCTGGGGCTCCGGCACACCTCAATGCGATCCTAGACATCTACGTCGTC
TAAATTATAACTTCTTTGCTGAACTTTTAATTAAAGACGCAGACCTTTTA
CTGAACTTTCCCTATGTATGGGGAGGACGGTCTGTACACGAAAGTCTGGA
AAAGCCGGGTGTTGATTGTTCGGGATTTATCAATATCCTTTACCAGGCAC
AGGGATACAACGTCCCTAGAAACGCTGCAGATCAATATGCGGATTGTCAT
TGGATCTCTAGCTTTGAGAACCTTCCTTCTGGTGGGTTAATATTTCTTTA
CCCTAAAGAAGAAAAGCGTATTTCTCATGTTATGTTGAAACAGGATAGTT
CCACCCTCATTCATGCTTCTGGTGGAGGGAAAAAAGTGGAGTATTTCATT
TTAGAACAAGATGGGAAGTTTTTAGATTCGACTTATCTATTTTTTAGAAA
TAATCAGAGGGGACGGGCATTTTTTGGGATCCCTAGAAAAAGAAAAGCCT
TTCTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy