Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR210 IGR208 IGR206 IGR199 IGR205 IGR209 IGR204 IGR201 IGR202 IGR207 IGR200 IGR203 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 CPn0251 rl33, - CPn0250 rs9, - CPn0246 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 CPn0243 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 CPn0251
* Calculated from Protein Sequence

Gene ID: CPn0244

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adk  

Definition:
adenylate kinase

Gene Start:
280918

Gene Stop:
281559

Gene Length:
642

Molecular Weight*:
23905

pI*:
7.20

Net Charge*:
0.78

EC:
2.7.4.3  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; nucleotide and nucleoside interconversions  

Pathway: pathway table
Purine metabolism

Comment:
Converts AMP (or dAMP) to ADP (or dADP).

Blast Summary:  PSI-Blast Search
CPn0244 is similar to CT128, a predicted adk adenylate kinase. Residues 8-208 are 45% similar to CT128.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0563
COG name: Adenylate kinase/yeast uridylate kinase
Functional Class: F
The phylogenetic pattern of COG0563 is a--kYqvCebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 9 to 190 (E-value = 1.4e-61) place CPn0244 in the ADK family which is described as Adenylate kinase (PF00406)

PDB Hit:


Gene Protein Sequence:
VTKGSVFIIMGPPGSGKGTQSQYLANRIGLPHISTGDLLRAIIREGTPNG
LKAKAYLDKGAFVPSDFVWEILKEKLQSQACSKGCIIDGFPRTLDQAHLL
DSFLMDVHSNYTVIFLEISEDEILKRVCSRFLCPSCSRIYNTSQGHTECP
DCHVPLIRRSDDTPEIIKERLTKYQERTAPVIAYYDSLGKLCRVSSENKE
DLVFEDILKCIYK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACTAAGGGCTCTGTTTTTATTATTATGGGGCCTCCAGGCTCAGGCAA
AGGAACCCAATCTCAATATCTTGCCAATAGAATAGGCTTACCCCACATCA
GTACTGGGGATTTATTAAGAGCGATTATTCGAGAAGGAACTCCTAATGGA
TTGAAGGCTAAAGCCTACCTAGATAAGGGTGCTTTTGTTCCTAGTGATTT
TGTATGGGAAATACTGAAAGAAAAACTGCAAAGCCAAGCCTGCTCTAAAG
GATGCATTATCGATGGGTTCCCGAGAACCTTAGATCAGGCGCATCTTCTG
GATAGTTTTCTTATGGACGTCCATTCTAACTACACGGTGATTTTCCTAGA
GATTTCTGAAGACGAGATCTTAAAAAGAGTGTGTTCAAGATTTCTTTGCC
CCTCCTGTTCGCGTATCTACAACACAAGTCAGGGACATACCGAATGTCCA
GACTGTCATGTGCCTTTGATACGGCGTTCTGACGATACCCCGGAAATCAT
TAAAGAAAGATTAACAAAATATCAAGAACGCACAGCTCCTGTTATTGCCT
ATTATGACAGCTTAGGGAAGCTATGTAGGGTTTCTTCTGAAAACAAAGAG
GATCTTGTTTTTGAAGACATTTTGAAATGCATTTATAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy