Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR208 IGR206 IGR199 IGR205 IGR198 IGR204 IGR201 IGR202 IGR207 IGR200 IGR203 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238 rs9, - CPn0246 CPn0243 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238 rs9, - CPn0246 CPn0242 rl13, - CPn0247 ycfV, - CPn0248 CPn0241 CPn0240 CPn0249 CPn0243 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238
* Calculated from Protein Sequence

Gene ID: CPn0243

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
280555

Gene Stop:
280130

Gene Length:
426

Molecular Weight*:
15475

pI*:
8.20

Net Charge*:
3.84

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18396.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Single hit to hypothetical protein in C.pneumoniae: residues 1-114 are 40% similar to residues 1-112 of CPn0242.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
29  
49
transmembrane  
54  
71
transmembrane  
97  
114

PDB Hit:


Gene Protein Sequence:
MACSIGYHLCNANEPDRFVASKVALVADILLYPFMAVICAVVFAVLMVVK
LLFLAIKFLVNTCIAACKSRPLPSCKENFQCLFGPKDKPGPSDWLGCLVL
IPIIGTLIYSTIITVQSDTNRLRYFIISPAYQVGSTAIINW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTGTTCTATTGGTTATCATCTGTGTAATGCAAACGAGCCCGACAG
ATTCGTTGCGTCGAAAGTAGCTCTAGTTGCAGATATTCTTCTCTACCCTT
TTATGGCGGTCATTTGTGCAGTTGTTTTTGCCGTCTTGATGGTAGTAAAA
CTACTGTTTTTAGCTATAAAATTCCTTGTTAATACCTGTATTGCAGCTTG
TAAATCAAGGCCTCTGCCCTCGTGTAAAGAGAATTTTCAATGCTTGTTTG
GACCAAAGGATAAACCAGGTCCATCAGATTGGTTAGGATGCCTAGTACTT
ATTCCGATCATAGGGACCCTAATTTATAGCACGATTATTACAGTACAATC
GGATACTAATCGTTTAAGATACTTTATTATATCTCCTGCTTATCAAGTGG
GATCAACTGCTATTATAAATTGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy