Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR199 IGR198 IGR204 IGR197 IGR201 IGR202 IGR200 IGR203 CPn0243 CPn0242 CPn0241 CPn0240 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238 pyrG, - CPn0236 CPn0243 CPn0242 CPn0241 CPn0240 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238 pyrG, - CPn0236 CPn0242 CPn0241 CPn0240 CPn0243 adk, - CPn0244 nagB  zwf,devB, - CPn0239 ydhO, - CPn0245 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 yqgF, - CPn0237
* Calculated from Protein Sequence

Gene ID: CPn0240

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
277861

Gene Stop:
276695

Gene Length:
1167

Molecular Weight*:
41042

pI*:
8.30

Net Charge*:
7.41

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18393.

Blast Summary:  PSI-Blast Search
CPn0240 is weakly similar to CT135: residues 117-292 of CPn0240 are 20% similar to residues 131-311 of CT135.

No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Single probable paralog found in C.pneumoniae, a hypothetical protein: residues 105-309 are 36% similar to residues 114-320 of CPn0241.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
57
transmembrane  
75  
92
transmembrane  
109  
131
transmembrane  
187  
211
transmembrane  
218  
242
non-globular  
315  
388

PDB Hit:


Gene Protein Sequence:
LVYFMVFSPSSESVVKANSVVRSNFCYFLENKFVSPSESTEVMFSEIMKG
RVPDIESLFDRPTDMMMTGFKAAQNLGNLFNSFGILIMCFSQCKSCQTPE
KETSAIVLGATLLFFVVALILGPTLGALVYCAYKVYTLGKMIYSLNKAKA
KVLRHPAQNVFHRAAGVATIRSSEEAVKACKLYKSAMIGSLVVSLIASLA
LIALTAGIVLVLFFVAPGAAPVITAAMMGCCAAGGGALLISLLGLWIAIV
RKAKHQEACVGHLTNVVLHTAVSEALLHDPSHFQTNALARDLFLTDCLSH
YGHLFSNEEVAQLVQGGAPGGGSRPSQHYGGSSDYQNRRGGNGNFGGSHF
GGGGGFAGSHFGAGYPTAPTMPSAPPPFPPPAYDTIYG$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTTTATTTTATGGTGTTTTCCCCTTCCTCAGAATCTGTTGTTAAAGC
TAATTCAGTGGTGCGCAGTAACTTCTGTTATTTTCTAGAAAACAAATTTG
TATCTCCTTCCGAGAGTACAGAAGTAATGTTTAGTGAGATCATGAAGGGA
CGAGTTCCTGATATTGAATCTCTATTTGATAGACCAACCGACATGATGAT
GACAGGGTTTAAAGCTGCGCAGAATTTGGGGAATTTGTTCAATAGCTTCG
GAATATTGATTATGTGCTTTTCGCAATGTAAGAGCTGTCAAACTCCAGAA
AAAGAGACATCAGCGATCGTTTTAGGAGCTACACTACTTTTCTTCGTAGT
TGCTCTTATCCTAGGACCGACATTAGGTGCCCTGGTTTATTGTGCTTATA
AAGTTTATACGCTTGGGAAGATGATTTACTCTCTGAATAAGGCGAAGGCA
AAAGTATTACGTCATCCTGCTCAAAATGTCTTCCATCGAGCTGCAGGTGT
TGCAACCATAAGGTCATCAGAAGAGGCTGTAAAAGCGTGTAAGTTGTATA
AGAGTGCTATGATAGGGTCCTTAGTCGTTAGCTTAATAGCTTCTTTAGCT
TTAATAGCCTTAACAGCTGGCATTGTCTTAGTATTATTTTTTGTAGCTCC
TGGAGCTGCTCCCGTAATTACTGCGGCAATGATGGGGTGCTGCGCTGCAG
GTGGAGGCGCTCTGTTAATTTCTCTGCTAGGACTATGGATTGCTATAGTT
CGTAAGGCAAAGCACCAAGAGGCATGCGTGGGTCACCTAACGAATGTTGT
TTTGCATACTGCCGTTAGTGAGGCTCTGCTACATGATCCCTCTCATTTCC
AAACAAATGCATTGGCAAGAGACCTATTTCTCACAGACTGTCTGTCTCAT
TATGGACACCTCTTCTCTAACGAAGAAGTTGCTCAGTTAGTTCAAGGAGG
AGCTCCTGGTGGAGGTTCTCGACCATCTCAGCATTATGGAGGCTCCTCTG
ATTATCAGAATAGAAGAGGAGGAAACGGTAATTTTGGAGGAAGTCACTTT
GGTGGGGGAGGGGGCTTTGCAGGATCCCATTTTGGAGCAGGATACCCTAC
GGCTCCTACCATGCCTAGTGCTCCTCCTCCTTTTCCACCGCCGGCTTACG
ATACTATCTACGGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy