Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR199 IGR198 IGR197 IGR201 IGR196 IGR202 IGR200 IGR203 CPn0243 CPn0242 CPn0241 CPn0240 adk, - CPn0244 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0243 CPn0242 CPn0241 CPn0240 adk, - CPn0244 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0242 CPn0241 CPn0240 CPn0243 adk, - CPn0244 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0239

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nagB zwf  devB  

Definition:
DevB protein (putative oxidoreductase)

Gene Start:
275899

Gene Stop:
276675

Gene Length:
777

Molecular Weight*:
29319

pI*:
4.80

Net Charge*:
-10.07

EC:
 

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0239 is similar to TP0477 in T. pallidum.

CPn0239 is orthologously related to CT186, a predicted nagB/devB/zwf glucosamine-6-phosphate isomerase. Residues 1-257 are 50% similar to CT186.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0363
COG name: Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase)
Functional Class: G
The phylogenetic pattern of COG0363 is ----Y-vcEBrHuj--Olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MATLINFNDTNKLLLTKQPSLFIDLASKDWIASANQAIKQRGAFYVALSG
GKTPLEIYKDIVINKDKLIDPSKIFLFWGDERLAPITSSESNYGQAMSIL
RDLNIPDEQIFRMETENPDGAKKYQELIENKIPDASFDMIMLGLGEDGHT
LSLFSNTSALEEENDLVVFNSVPHLETERMTLTFPCVHKGKHVVVYVQGE
NKKPILKSVFFSEGREEKLYPIERVGRDRSPLFWIISPESYDIADFDNIS
SIYKMDIL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACACTGATAAATTTCAATGATACGAACAAACTTTTGCTTACAAA
GCAACCTTCTCTATTTATAGATCTAGCTAGTAAAGATTGGATAGCTTCTG
CGAACCAGGCAATTAAGCAACGGGGAGCATTTTATGTAGCATTATCTGGA
GGCAAAACTCCTTTAGAAATCTATAAAGATATCGTTATCAATAAAGACAA
ACTTATAGATCCTAGTAAGATTTTTCTATTTTGGGGAGATGAAAGACTAG
CTCCGATAACATCGTCAGAAAGTAATTACGGCCAGGCTATGAGCATTCTC
CGTGATTTGAATATTCCTGATGAGCAGATCTTTCGAATGGAAACAGAAAA
TCCCGATGGAGCGAAAAAATACCAAGAACTTATAGAAAATAAAATTCCTG
ATGCTAGCTTTGATATGATTATGTTAGGACTAGGAGAAGATGGTCACACC
CTTTCTCTTTTTTCCAATACCTCGGCTTTGGAGGAGGAAAATGACCTTGT
GGTCTTTAATTCTGTTCCACATCTAGAAACAGAAAGAATGACCTTAACCT
TTCCTTGCGTACATAAAGGCAAGCATGTTGTTGTTTATGTTCAGGGGGAA
AATAAAAAGCCTATCCTTAAAAGTGTCTTCTTTTCTGAAGGTAGAGAAGA
AAAACTCTATCCTATAGAGCGTGTAGGTAGGGACCGCTCACCTCTATTTT
GGATTATTTCTCCAGAATCTTATGATATAGCAGACTTCGATAATATCTCT
TCGATATATAAAATGGACATCCTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy