Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR199 IGR198 IGR197 IGR195 IGR194 IGR201 IGR196 IGR202 IGR200 CPn0233 CPn0242 CPn0234 CPn0232 CPn0241 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0242 CPn0234 CPn0232 CPn0241 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0242 CPn0232 CPn0241 CPn0240 CPn0234 CPn0233 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0238

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
zwf  

Definition:
glucose-6-phosphate dehydrogenase

Gene Start:
274303

Gene Stop:
275841

Gene Length:
1539

Molecular Weight*:
58730

pI*:
6.60

Net Charge*:
-1.79

EC:
1.1.1.49  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Comment:


Blast Summary:  PSI-Blast Search
CPn0238 is similar to TP0478, a predicted
glucose-6-phosphate 1-dehydrogenase in T. pallidum.

CPn0238 is orthologously related to CT185 and
they share 72% similarity.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0364
COG name: Glucose-6-phosphate 1-dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0364 is ----yqvcebRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 16 to 210 (E-value = 9.1e-68) place CPn0238 in the G6PD_N family which is described as Glucose-6-phosphate dehydrogenase, NAD binding domain (PF00479)
Residues 212 to 512 (E-value = 3.1e-133) place CPn0238 in the G6PD_C family which is described as Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781)

PDB Hit:


Gene Protein Sequence:
MTNVVQETIGGLNSPRTCPPCILVIFGATGDLTARKLLPALYHLTKEGRL
SDQFVCVGFARREKSNELFRQEMKQAVIQFSPSELDIKVWEDFQQRLFYH
RSEFDNNMGYTSLKDSLEDLDKTYGTRGNRLFYLSTPPQYFSRIIENLNK
HKLFYKNQDQGKPWSRVIIEKPFGRDLDSAKQLQQCINENLNENSVYHID
HYLGKETVQNILTTRFANTIFESCWNSQYIDHVQISLSETIGIGSRGNFF
EKSGMLRDMVQNHMMQLLCLLTMEPPTTFDADEIRKEKIKILQRISPFSE
GSSIVRGQYGPGTVQGVSVLGYREEENVDKDSRVETYVALKTVINNPRWL
GVPFYLRAGKRLAKKSTDISIIFKKSPYNLFAAEECSRCPIENDLLIIRI
QPDEGVALKFNCKVPGTNNIVRPVKMDFRYDSYFQTTTPEAYERLLCDCI
IGDRTLFTGGDEVMASWKLFTPVLEEWDQDSSPSFPNYPAGSSGPKEADA
LIERDGRSWRPL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGAATGTTGTTCAGGAAACTATAGGTGGATTGAATTCCCCACGAAC
GTGCCCTCCTTGTATTTTAGTTATCTTTGGAGCGACTGGAGATCTGACGG
CAAGGAAACTTTTACCCGCTCTATATCACCTCACTAAAGAAGGACGCCTT
TCAGACCAGTTTGTTTGCGTAGGATTTGCACGTCGAGAGAAATCGAATGA
ACTGTTCCGCCAAGAGATGAAACAAGCTGTCATACAATTTTCTCCTTCCG
AATTAGATATTAAGGTATGGGAAGATTTCCAACAGCGCCTCTTTTATCAT
CGCTCAGAATTCGATAACAATATGGGATATACATCTCTCAAGGACTCCTT
AGAAGATTTAGATAAAACGTACGGAACACGTGGAAATCGTCTTTTTTATC
TTTCTACTCCCCCCCAATATTTTTCTAGAATCATTGAAAATTTAAATAAA
CATAAGCTTTTCTATAAAAATCAAGACCAAGGGAAACCCTGGTCCCGTGT
CATTATAGAAAAACCTTTTGGAAGAGACTTAGATAGTGCTAAGCAACTTC
AGCAATGTATCAATGAGAATCTTAATGAAAATTCGGTCTATCATATAGAT
CACTATTTAGGGAAAGAAACGGTTCAAAACATCTTAACAACACGTTTCGC
CAATACGATTTTCGAATCGTGTTGGAATTCACAATATATCGATCATGTCC
AAATCAGTTTGAGTGAAACGATTGGCATAGGATCTCGCGGCAATTTCTTT
GAGAAATCTGGGATGCTTCGGGATATGGTACAGAACCATATGATGCAGCT
ACTCTGTTTACTCACTATGGAGCCTCCTACAACTTTTGATGCTGATGAAA
TCAGAAAAGAAAAAATCAAAATTCTTCAACGTATCTCACCATTTTCAGAA
GGTTCTTCGATTGTCCGAGGACAATATGGTCCAGGAACGGTTCAAGGAGT
CTCGGTCCTTGGCTATCGTGAAGAAGAGAATGTTGACAAAGATTCCCGAG
TAGAGACCTACGTAGCTTTAAAAACAGTCATTAATAATCCCCGTTGGCTT
GGAGTTCCTTTCTATTTACGTGCAGGAAAACGACTCGCCAAAAAATCTAC
AGACATTTCTATTATTTTTAAAAAATCACCCTACAATTTATTTGCAGCCG
AAGAATGTTCACGTTGTCCGATAGAAAATGATTTGCTAATCATCAGAATT
CAACCGGACGAAGGTGTCGCTTTGAAATTCAACTGTAAGGTTCCAGGAAC
TAATAATATTGTCCGTCCTGTTAAGATGGACTTCCGTTACGACAGCTATT
TCCAAACTACAACTCCAGAAGCATACGAGCGTTTATTATGTGATTGCATT
ATAGGGGATCGTACGTTATTTACTGGTGGAGATGAAGTTATGGCTTCTTG
GAAGCTTTTTACTCCTGTATTAGAGGAGTGGGACCAAGATTCCTCACCCT
CGTTTCCAAACTATCCTGCAGGATCTTCAGGTCCTAAAGAAGCTGATGCT
CTCATTGAAAGAGACGGAAGAAGCTGGAGACCTTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy