Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR199 IGR198 IGR197 IGR195 IGR194 IGR196 IGR193 IGR200 CPn0233 CPn0234 CPn0232 CPn0241 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0234 CPn0232 CPn0241 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0234 CPn0232 CPn0241 CPn0240 CPn0233 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0237

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yqgF  

Definition:
conserved hypothetical protein (basic)(YqgF family)

Gene Start:
273762

Gene Stop:
274217

Gene Length:
456

Molecular Weight*:
16567

pI*:
9.90

Net Charge*:
6.09

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0237 is orthologously related to CT184: residues 8-144 of CPn0237 are 64% similar to residues 8-144 of CT184, a predicted conserved hypothetical protein (basic)(YQGF family) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0816
COG name: Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis)
Functional Class:  L
The phylogenetic pattern of COG0816 is -----qvcebrhujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 144 (E-value = 4.4e-67) place CPn0237 in the UPF0081 family which is described as Uncharacterised protein family (UPF0081) (PF03652)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
75

PDB Hit:


Gene Protein Sequence:
MSKPSSCKAYLGIDYGKKRIGLAYAAEPLLLTLPIGNIEAGKNLKLSAEA
LHKIILSRNITCVVLGNPLPMQKGLYSSLQEEVSLLAEELKKLSTVEIIL
WDERLSSVQAERMLKQDCGLSRKDRKGKTDSLAATLILTSFLDSLPKKLT
L$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAGCCATCTAGTTGCAAAGCATACCTTGGCATAGACTACGGGAA
AAAACGGATCGGCCTTGCCTATGCAGCCGAACCCCTCCTATTGACACTAC
CGATTGGAAATATAGAAGCAGGTAAAAATCTTAAGTTGTCAGCAGAAGCT
CTTCATAAGATTATTTTAAGTAGAAATATAACTTGTGTAGTTCTAGGGAA
TCCCCTTCCTATGCAAAAAGGTCTTTACTCATCTCTGCAAGAGGAAGTTT
CCTTACTTGCTGAGGAGCTTAAGAAGCTTTCTACGGTAGAAATCATCCTA
TGGGATGAACGGCTTTCTTCAGTACAAGCGGAACGTATGTTAAAGCAAGA
TTGTGGACTAAGCAGAAAAGATCGGAAAGGAAAAACAGATTCCCTGGCTG
CAACATTAATCTTAACAAGTTTTCTAGATAGCTTACCTAAAAAACTAACC
TTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy