Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR199 IGR198 IGR197 IGR195 IGR194 IGR196 IGR193 IGR200 CPn0233 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 CPn0230 CPn0230 CPn0233 nagB  zwf,devB, - CPn0239 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0236

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrG  

Definition:
CTP synthetase (UTP ammonia ligase)

Gene Start:
272156

Gene Stop:
273769

Gene Length:
1614

Molecular Weight*:
59607

pI*:
6.00

Net Charge*:
-13.18

EC:
6.3.4.2  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Comment:
See Tipples and McClarty, JBC 270:7908, 1995.
The C. trachomatis enzyme is reported to be sensitive to feedback inhibition

by CTP. Cyclopentanyl cytosine (CPEC) inhibits except in mutant strain
L2/CPFC for which D149 -> E (JBC 271:15393,1996).

Blast Summary:  PSI-Blast Search
CPn0236 is orthologusly related top CT183, a predicted CTP synthetase: residues
1-536 are 67% similar to CT183. CPn0236 is also similar to TP0305 and UU284,
both predicted CTP synthases.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0504
COG name: CTP synthase (UTP-ammonia lyase)
Functional Class:  F
The phylogenetic pattern of COG0504 is amtkYqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 280 (E-value = 7.5e-192) place CPn0236 in the CTP_synth_N family which is described as CTP synthase N-terminus (PF06418)
Residues 302 to 526 (E-value = 6.1e-67) place CPn0236 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

PDB Hit:


Gene Protein Sequence:
MPFKCIFLTGGVVSSLGKGLTAASLALILERQRLNVAMLKLDPYLNVDPG
TMNPFEHGEIYVTDDGVETDLDLGHYHRFSSAALSRHSSATSGQIYARVI
KREREGDYLGSTVQVIPHITNEIIQVILDAAKEHSPDVLIVEIGGTIGDI
ESLPFLEAIRQFRYDHSEDCLNIHMTYVPYLQAADEVKSKPTQHSVQTLR
GIGIIPDAILCRSEKPLTQEVKSKISLFCNVPNRAVFNVIDVKHTIYEMP
LMLAQEKIANFIGEKLKLATVPENLDDWKVLVNQLSQDLPKVKIGVVGKY
VQHRDAYKSIFEALTHAALRLGHAAEIIPIDAEDENLTMELSQCDACLVP
GGFGVRGWEGKIAAAKFCREQGIPYFGICLGMQVLVVEYARNVLNLDQAN
SLEMDPNTPHPIVYVMEGQDPLVATGGTMRLGAYPCLLKPGSKAHKAYNE
SSLIQERHRHRYEVNPDYIQSLEDHGLRIVGTCPPQGLCEIIEVSDHPWM
IGVQFHPEFVSKLISPHPLFIAFIEAALVYSKDASHV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTTCAAATGCATATTTTTAACAGGAGGAGTTGTCTCCTCTTTAGG
AAAAGGGTTAACAGCAGCATCCCTAGCCCTAATTTTAGAACGTCAACGGC
TTAACGTTGCTATGTTAAAATTGGATCCATATCTAAATGTAGATCCAGGA
ACTATGAATCCCTTTGAGCATGGAGAAATCTATGTTACAGATGATGGGGT
TGAGACAGATCTTGATCTCGGTCACTATCATAGATTCTCTTCTGCTGCAC
TTTCTAGACATTCAAGTGCCACTTCAGGTCAAATTTATGCTCGTGTCATT
AAAAGAGAGCGTGAGGGTGATTATCTAGGAAGCACGGTACAAGTCATCCC
ACACATTACCAATGAAATCATTCAAGTCATTTTAGACGCAGCTAAAGAGC
ACTCTCCAGATGTTCTTATTGTCGAGATTGGAGGGACCATAGGAGATATT
GAATCTCTTCCCTTCCTAGAAGCAATTCGACAATTTCGGTATGACCATTC
CGAAGATTGTCTAAATATTCATATGACTTATGTCCCCTATTTACAGGCTG
CTGACGAAGTTAAAAGTAAGCCAACGCAACACTCCGTACAAACTCTACGT
GGTATTGGCATCATTCCCGACGCGATTCTATGTCGTTCTGAAAAACCTTT
AACTCAAGAAGTTAAATCTAAAATCAGTCTCTTTTGCAATGTTCCCAACC
GGGCAGTGTTTAACGTTATAGATGTAAAACATACCATTTATGAAATGCCT
TTGATGCTTGCTCAAGAGAAAATTGCCAATTTCATAGGGGAAAAGTTAAA
GTTAGCTACGGTTCCAGAAAATCTTGATGACTGGAAGGTACTGGTAAATC
AGCTATCTCAAGATCTTCCGAAGGTAAAAATTGGAGTCGTTGGGAAGTAT
GTTCAACACCGAGATGCCTATAAGTCCATATTCGAAGCACTCACTCATGC
AGCTTTAAGATTAGGTCATGCTGCTGAAATTATCCCTATTGATGCTGAAG
ATGAAAATCTTACTATGGAACTCTCTCAATGCGACGCATGTTTAGTTCCT
GGAGGCTTCGGCGTTCGTGGTTGGGAAGGAAAAATCGCTGCAGCTAAATT
CTGTCGAGAACAAGGCATTCCTTATTTTGGTATTTGCCTAGGAATGCAAG
TGCTTGTTGTAGAGTATGCTCGCAATGTCTTAAATCTGGATCAGGCAAAT
TCCCTAGAAATGGACCCCAACACCCCTCATCCTATTGTATATGTCATGGA
GGGGCAAGATCCCTTAGTAGCTACGGGAGGCACCATGCGCTTAGGAGCGT
ATCCTTGTCTATTAAAGCCAGGGAGCAAAGCCCATAAAGCATATAACGAA
TCTTCTCTGATTCAGGAGCGCCACCGCCATCGCTATGAAGTAAATCCGGA
TTACATACAGAGTTTAGAAGACCACGGCTTACGGATCGTTGGGACTTGTC
CTCCACAAGGGCTTTGTGAAATTATTGAAGTTTCGGATCATCCTTGGATG
ATTGGTGTGCAATTCCATCCAGAATTTGTATCTAAACTCATCTCTCCCCA
TCCTCTATTTATCGCATTTATAGAAGCAGCTCTAGTCTATTCTAAGGATG
CAAGCCATGTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy