Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR199 IGR198 IGR197 IGR195 IGR194 IGR196 IGR193 CPn0233 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 nagB  zwf,devB, - CPn0239 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 nagB  zwf,devB, - CPn0239 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0234 nrtC,tauB, - CPn0231 CPn0232 CPn0240 CPn0230 CPn0230 CPn0233 nagB  zwf,devB, - CPn0239 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0235

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kdsB  

Definition:
CMP-2-keto-3-deoxyoctulosonic acid synthetase

Gene Start:
271416

Gene Stop:
272180

Gene Length:
765

Molecular Weight*:
28400

pI*:
5.90

Net Charge*:
-4.63

EC:
2.7.7.38  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Fructose and mannose metabolism

Comment:
See Tipples and McClarty, JBC 270:7908,1995. This enzyme converts
3-deoxy-D-manno-octulosonate to CMP-3-deoxy-D-manno-octulosonate.

Blast Summary:  PSI-Blast Search
CPn0235 is orthologous to CT182, a predicted CMP-2-keto-3-deoxyoctulosonic acid synthetase:
residues 11-254 are 62% similar to CT182. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1212
COG name: CMP-2-keto-3-deoxyoctulosonic acid synthetase
Functional Class:  M
The phylogenetic pattern of COG1212 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 11 to 221 (E-value = 7.7e-94) place CPn0235 in the CTP_transf_3 family which is described as Cytidylyltransferase (PF02348)

PDB Hit:


Gene Protein Sequence:
MKPEESECLCIGVLPARWNSSRYPGKPLAKIHGKSLIQRTYENASQSSLL
DKIVVATDDQHIIDHVTDFGGYAVMTSPTCSNGTERTGEVARKYFPKAEI
IVNIQGDEPCLNSEVVDALVQKLRSSPEAELVTPVALTTDREEILTEKKV
KCVFDSEGRALYFSRSPIPFILKKATPVYLHIGVYAFKREALFRYLQHSS
TPLSDAEDLEQLRFLEHGGKIHVCIVDAKSPSVDYPEDIAKVEQYITCLS
NAYF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCCGGAAGAGTCTGAGTGTCTGTGTATTGGAGTTTTGCCCGCACG
CTGGAATAGCAGTCGCTATCCAGGAAAGCCTTTGGCTAAAATTCATGGAA
AAAGCTTAATACAAAGAACTTATGAGAATGCTTCCCAAAGTTCTCTATTA
GATAAAATTGTTGTTGCTACTGACGATCAGCATATTATCGACCACGTGAC
TGATTTTGGTGGTTATGCAGTGATGACTTCTCCTACATGTTCCAATGGTA
CAGAACGCACAGGTGAAGTAGCTAGAAAGTACTTCCCTAAAGCTGAGATT
ATTGTAAATATTCAAGGTGATGAGCCTTGTCTAAATTCTGAGGTTGTCGA
CGCTTTGGTTCAGAAGTTGAGAAGTTCTCCTGAAGCAGAACTGGTGACTC
CTGTGGCACTCACGACAGATCGTGAAGAGATCTTAACAGAAAAAAAAGTA
AAATGTGTTTTTGACTCTGAGGGAAGGGCTCTGTATTTTAGTCGCAGTCC
TATTCCTTTTATTCTTAAAAAAGCAACCCCGGTATATCTCCATATTGGAG
TATATGCTTTTAAAAGAGAGGCTCTTTTCCGCTACCTACAGCATAGCTCA
ACTCCTCTAAGCGATGCCGAAGATCTTGAGCAATTACGTTTCCTAGAACA
TGGAGGCAAGATCCATGTGTGTATCGTAGATGCAAAAAGTCCCTCTGTTG
ATTATCCAGAAGACATAGCTAAAGTAGAACAATATATCACATGCCTTTCA
AATGCATATTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy