Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR198 IGR197 IGR195 IGR194 IGR196 IGR191 IGR193 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0230 CPn0230 CPn0233 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0234

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
271240

Gene Stop:
270545

Gene Length:
696

Molecular Weight*:
26440

pI*:
7.60

Net Charge*:
1.12

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0234 is orthologously related to CT181, a Chlamydia-specific hypothetical protein. Residues 1-231 are 58% similar to CT181.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26

PDB Hit:


Gene Protein Sequence:
MLQSCKKALLSIVVSILAFHPIPGMGVEAKSGFLGKVKGWFSKKEIQEEA
RILPVKDSLSWKRYDYTSSSGFSVEFPGEPDHSGQIVEVPQSEITIRYDT
YVTETHPDNTVYVVSVWEYPEKVDISRPELNLQEGFSGMMQALPESQVLF
MQARQIQGHKALEFWIVCEDVYFRGMLISVNHTLYQVFMVYKNKNPQALD
KEYEAFSQSFKITKIREPRTIPSSVKKKVSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTGCAGAGTTGCAAAAAGGCCTTATTATCCATAGTAGTATCGATTTT
AGCTTTTCACCCTATCCCTGGTATGGGAGTCGAAGCTAAATCTGGTTTTT
TAGGGAAAGTCAAAGGATGGTTCTCAAAAAAAGAGATTCAGGAAGAGGCT
AGAATTTTACCAGTTAAAGACAGTCTTTCATGGAAACGCTATGACTATAC
ATCAAGTTCTGGGTTTTCTGTGGAATTTCCTGGGGAGCCTGATCATTCGG
GGCAAATTGTAGAAGTCCCTCAATCAGAGATTACCATACGTTATGATACC
TATGTAACAGAGACTCATCCAGACAACACTGTGTATGTAGTCTCTGTTTG
GGAGTATCCTGAAAAAGTAGATATAAGTCGTCCAGAGCTCAATCTGCAAG
AGGGGTTTTCAGGCATGATGCAGGCTCTCCCTGAATCCCAGGTTCTTTTC
ATGCAAGCAAGGCAGATTCAAGGCCATAAGGCTTTGGAATTTTGGATTGT
TTGCGAAGATGTTTATTTCAGAGGGATGTTGATTTCCGTAAATCACACTC
TTTATCAAGTCTTTATGGTTTATAAGAATAAGAATCCTCAGGCCTTGGAT
AAAGAATACGAGGCGTTTTCTCAGTCTTTTAAAATTACTAAAATACGAGA
ACCAAGAACGATTCCTTCTTCAGTGAAAAAGAAAGTGAGTCTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy