Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR190 IGR197 IGR195 IGR194 IGR196 IGR191 IGR193 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0226 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0226 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0233 CPn0226 CPn0229 zwf, - CPn0238 pyrG, - CPn0236 yqgF, - CPn0237 kdsB, - CPn0235 yqgF, - CPn0237 kdsB, - CPn0235
* Calculated from Protein Sequence

Gene ID: CPn0232

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (similar to 5'-Methylthioadenosine nucleosidase)

Gene Start:
270122

Gene Stop:
269229

Gene Length:
894

Molecular Weight*:
33529

pI*:
7.20

Net Charge*:
1.13

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possibly C. pneumoniae-specific protein. See CPn0193 for another potential C. pneumoniae-specific protein. No PROSITE patterns corresponding to this protein sequence were found.

Blast Summary:  PSI-Blast Search
Two weak hits in gapped BLAST to 5'-Methylthioadenosine Nucleosidase sequences; e.g. residues 63-257 are 20% similar to PFS_HAEIN; residues 90-297 are 22% similar to (AF012886) Pfs [Buchnera aphidicola].
No orthologs in C. trachomatis.


COGS Summary:  COGS Search
BeTs to 5 clades of COG0775
COG name: Nucleoside phosphorylase
Functional Class:  F
The phylogenetic pattern of COG0775 is ------vcEbRhuj--OliN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 205-250 are 30% similar to a nucleosidase domain of PFS_HAEIN.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
16
transmembrane  
93  
111

PDB Hit:


Gene Protein Sequence:
MRRFLFLILSSLPLVAFSADNFTILEEKQSPLSRVSIIFALPGVTPVSFD
GNCPIPWFSHSKKTLEGQRIYYSGDSFGKYFVVSALWPNKVSSAVVACNM
ILKHRVDLILIIGSCYSRSQDSRFGSVLVSKGYINYDADVRPFFERFEIP
DIKKSVFATSEVHREAILRGGEEFISTHKQEIEELLKTHGYLKSTTKTEH
TLMEGLVATGESFAMSRNYFLSLQKLYPEIHGFDSVSGAVSQVCYEYSIP
CLGVNILLPHPLESRSNEDWKHLQSEASKIYMDTLLKSVLKELCSSH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCGTTTTCTGTTTCTTATTCTTAGCTCTCTTCCTTTGGTCGCATT
CTCTGCTGATAATTTCACTATTCTAGAAGAAAAACAGAGTCCTTTAAGTC
GTGTAAGTATTATTTTTGCTTTACCTGGGGTTACTCCCGTTTCTTTTGAT
GGTAATTGTCCTATTCCTTGGTTTTCTCATAGTAAAAAGACTCTAGAGGG
ACAGAGAATTTATTACTCTGGCGACTCCTTTGGGAAATACTTTGTAGTTT
CTGCTCTTTGGCCTAATAAAGTTTCTTCAGCTGTTGTGGCTTGTAATATG
ATTCTTAAACATCGAGTGGATCTTATTCTAATTATAGGCTCGTGTTACTC
TAGGTCTCAAGATAGCCGTTTTGGCAGCGTCTTAGTTTCTAAAGGCTACA
TTAATTATGATGCAGATGTGAGGCCTTTCTTTGAAAGATTTGAGATTCCA
GACATTAAAAAGAGTGTTTTTGCAACCAGTGAGGTTCATCGGGAGGCAAT
TCTTCGTGGAGGCGAAGAGTTTATTTCTACCCATAAACAAGAAATCGAAG
AGCTTTTGAAGACTCATGGGTATTTGAAATCAACAACCAAAACGGAGCAC
ACCTTAATGGAAGGTTTGGTTGCTACAGGCGAGTCTTTCGCGATGTCGCG
AAACTATTTTCTTTCCTTACAAAAATTGTATCCAGAGATTCATGGTTTTG
ATAGTGTCAGCGGCGCTGTTTCTCAGGTATGCTATGAATATAGCATTCCT
TGTTTAGGTGTGAATATCCTTCTCCCTCATCCTTTAGAATCACGGAGTAA
CGAGGATTGGAAGCATCTTCAAAGTGAGGCAAGTAAAATTTATATGGATA
CCTTGCTCAAGAGTGTATTAAAAGAACTCTGTTCTTCTCATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy