Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR195 IGR194 IGR196 IGR188 IGR191 IGR193 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0226 CPn0225 CPn0229 pyrG, - CPn0236 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0226 CPn0225 CPn0229 pyrG, - CPn0236 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0233 CPn0225 CPn0229 pyrG, - CPn0236 kdsB, - CPn0235 kdsB, - CPn0235 CPn0224 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0231

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nrtC  tauB  

Definition:
ABC transporter (exact function unknown)

Gene Start:
268957

Gene Stop:
268250

Gene Length:
708

Molecular Weight*:
26297

pI*:
7.10

Net Charge*:
0.20

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0231 is similar to CT180, CT130, CT152, CT068, CT653, CT653, CT690, CT689, CT201, CT416, CT202, CT264, CT685, and CT348, all predicted transporters.
Residues 1-213 are 50% similar to CT180.
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 13-208 are 35% similar to (U50335) ORF3 [Mycobacterium smegmatis]; residues 16-220 are 34% similar to Y40S_RHISN; residues 2-203 are 33% similar to (U33937) FbpC [Neisseria gonorrhoeae]; residues 17-220 are 29% similar to TP0804; residues 16-188 are 33% similar to MG467, and residues 16-204 are 26% similar to UU069.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1118
COG name: ABC-type sulfate/molybdenum transport system, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1118 is amtk---cE-rH-------n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 32-43 and 129-160 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 2.3e-16.

ProDom Summary:  Protein Domain Search
Residues 19-62 are 54% similar to a defined domain of P72613_SYNY3, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Residues 128-167 are 54% similar to a defined domain of YABJ_ECOLI, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Numerous ABC transporters are possible paralogs, the most similar of which are: CPn0191, CPn0723, CPn0683, CPn0348, CPn0280, and CPn0542. Residues 2-210 are 31% similar to CPn0191.

Pfam Summary:  Pfam Search
Residues 27 to 205 (E-value = 3.6e-44) place CPn0231 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:


Gene Protein Sequence:
MLQAHRLCYSCDNQVILKDASFQASPGTITIILGSSGVGKTTLFRLLAGF
LPLQEGELLWNGSPLNRKDVAYMQQKEALLPWRTALKNMTLSTELGINTS
HNALSNERLEEIIHNFDLGQLLDRYPDELSGGQRQRIALAAQCLSLKPIL
LLDEPFSSLDVLLKEQLYQDIVALAKKENKTVLLVTHDFHDVSCLGDVLY
VIKNKTLTPVPLDPSMRPLNNGLCFIKDLKKHLYT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACAAGCTCATCGTCTATGCTATTCTTGTGACAATCAAGTCATTTT
AAAGGATGCTTCTTTCCAAGCGTCTCCAGGGACAATTACGATTATTTTAG
GAAGTTCTGGAGTTGGAAAGACAACTTTGTTTCGTTTGCTTGCGGGTTTC
CTACCTTTGCAAGAAGGCGAACTTCTATGGAATGGGAGCCCTCTAAATCG
CAAAGACGTTGCCTATATGCAGCAAAAAGAAGCCCTGCTTCCTTGGCGTA
CGGCTTTAAAAAACATGACGTTGTCAACGGAGCTTGGCATCAATACAAGT
CACAACGCCTTATCCAATGAACGCCTTGAAGAGATTATACACAATTTTGA
TCTCGGACAGCTTCTTGATCGTTATCCAGACGAACTTTCTGGAGGGCAAA
GGCAGCGCATCGCTCTTGCAGCTCAGTGCTTGTCTTTAAAGCCTATTCTC
CTTTTAGATGAACCTTTTTCGTCTTTGGACGTATTGCTTAAAGAACAGCT
CTACCAAGATATTGTTGCTTTAGCAAAGAAGGAAAATAAGACGGTGCTTC
TTGTCACTCACGACTTTCATGACGTTTCCTGTTTAGGGGATGTCTTGTAC
GTTATTAAGAACAAAACACTCACTCCTGTTCCTCTGGATCCTTCAATGAG
ACCTTTAAATAATGGGCTATGTTTCATTAAAGATTTAAAAAAGCACTTAT
ATACATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy