Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR195 IGR194 IGR196 IGR188 IGR191 IGR193 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0223 CPn0226 CPn0225 CPn0229 pyrG, - CPn0236 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0223 CPn0226 CPn0225 CPn0229 pyrG, - CPn0236 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0233 CPn0223 CPn0225 CPn0229 pyrG, - CPn0236 kdsB, - CPn0235 kdsB, - CPn0235 CPn0224 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0230

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
268253

Gene Stop:
267573

Gene Length:
681

Molecular Weight*:
25610

pI*:
10.00

Net Charge*:
9.54

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0230 is weakly similar to CT179, a hypothetical protein: residues 47-175 are 27% similar to CT179.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
38  
95
coil-coil  
178  
226

PDB Hit:


Gene Protein Sequence:
MSSQPLVTTSSSLSRYVVLTGEEKVACYKKAFNHIWHGAPAIILAAALLM
FCIFGFVLGSILLGAPLEGASILYDVILPWLLPSILVFVLLVLPLNIYAY
SHHKQVLALHERITQSNYKEIYDHCEKEKKTPNKKALSLYIESQVLVPEY
SKRFSSMILGKTLKIIPKKDSPESLKHDELIQKALERAKENIYMNKNQRE
KRDEREAKKEAKNASKTNPLWEGLGT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTCACAGCCTCTGGTCACCACTTCCTCTTCTTTAAGCCGTTATGT
TGTACTTACTGGGGAGGAGAAAGTAGCTTGCTACAAGAAAGCCTTTAATC
ATATTTGGCATGGGGCTCCTGCTATAATTTTAGCAGCAGCACTTCTCATG
TTTTGTATTTTTGGTTTTGTTTTAGGATCTATACTTTTGGGTGCTCCTCT
GGAAGGTGCATCTATTCTTTATGATGTGATTCTTCCCTGGCTATTACCCT
CGATTCTCGTTTTTGTTCTTCTTGTTTTGCCTTTGAATATCTATGCTTAT
TCCCACCATAAGCAAGTGTTGGCTCTCCATGAGAGGATTACACAGAGCAA
TTACAAAGAAATCTATGACCACTGTGAAAAAGAAAAGAAAACTCCTAATA
AGAAAGCTCTTTCTCTCTACATAGAATCTCAGGTGCTAGTACCTGAGTAT
AGCAAAAGATTCTCTTCTATGATCTTAGGTAAGACGCTTAAAATCATTCC
AAAAAAGGATTCTCCTGAATCTTTAAAACATGATGAGCTGATACAAAAAG
CTTTAGAGCGTGCTAAGGAGAATATCTACATGAACAAGAACCAAAGAGAA
AAGCGTGACGAACGCGAAGCTAAGAAAGAAGCAAAAAACGCCTCAAAAAC
CAATCCCTTATGGGAGGGGTTAGGCACGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy