Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR195 IGR194 IGR196 IGR188 IGR191 IGR193 IGR185 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0225 kdsB, - CPn0235 CPn0229 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0225 kdsB, - CPn0235 CPn0229 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0233 CPn0223 CPn0221 CPn0225 kdsB, - CPn0235 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0229

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
266328

Gene Stop:
267563

Gene Length:
1236

Molecular Weight*:
46211

pI*:
10.40

Net Charge*:
17.97

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Structural features suggest a membrane involvement.

Blast Summary:  PSI-Blast Search
CPn0229 is orthologously related to CT178: residues 1-403 of CPn0229 are 51% similar to residues 1-403 of CT178, a hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
98  
259

PDB Hit:


Gene Protein Sequence:
MDKETLENIYRHFRYRFLKLNILPAFLGLLLLCSPNTLNYTQVDVIFSDR
LCSCLLIFLAIASLTKRSLLWLGAPLGIWVTLFACVAGRSPTIFANDTLI
GFAILAVVCISPTRPEALEVGPTLPEGFSYNPSAGGRRAAVLFLSLLGWL
EARYLTASSLGITSSQSSNFLLLYSSIMTVYSLLVVLSLAGSERRWHTRP
KIVIATALALTGVIILTLLPIILHQLRYDCWLCLCLTIEPALAVVFAYDE
TRATLRYISQFLGDKRALTRASFFGSEYYKHTLSWEERTVLPLRKAYKQA
FEGISFPINQLLAILVATVFVKVNSSMGLPTFPRNFLNICCWFIIVLFIL
AFAESLRHLRWMNLIFSAAILFSPVLFHIPVESPMFLPIIVTGLILIILS
IGKRRRTKRKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAAGAAACACTAGAAAATATCTATCGACATTTTCGATACCGTTT
TTTAAAACTCAATATCCTCCCTGCATTTCTTGGTCTCCTTCTTCTATGTT
CTCCAAATACCCTAAATTATACACAAGTCGATGTCATCTTCTCTGATCGT
CTTTGTAGTTGTTTACTTATTTTCTTAGCTATTGCTTCCCTAACCAAACG
TTCTCTTCTCTGGTTAGGAGCCCCACTAGGCATCTGGGTTACCCTTTTCG
CCTGCGTTGCAGGACGATCTCCTACTATTTTTGCAAATGATACTCTAATT
GGATTCGCAATTCTTGCCGTAGTGTGTATTTCCCCTACACGACCCGAAGC
CCTTGAAGTAGGCCCGACATTACCTGAAGGTTTTTCTTACAATCCTTCTG
CAGGAGGACGCAGAGCTGCAGTACTATTCCTAAGCTTACTGGGGTGGCTA
GAAGCTCGGTATCTTACTGCTTCCAGCTTGGGAATTACATCGAGTCAGTC
TTCGAACTTCTTACTATTGTACTCATCTATAATGACTGTATACTCTCTGC
TCGTGGTTCTCTCTCTAGCAGGAAGTGAGCGCCGCTGGCACACAAGACCA
AAAATCGTAATAGCGACAGCCTTAGCTTTAACAGGCGTCATTATTTTAAC
TCTTCTCCCTATCATCCTACACCAACTGCGCTATGATTGCTGGCTATGCC
TTTGCCTAACTATAGAACCTGCTCTTGCCGTGGTCTTTGCTTACGATGAA
ACCAGGGCCACTTTGCGCTATATTTCTCAATTTTTAGGAGATAAACGAGC
TCTTACTAGAGCCTCGTTCTTTGGATCAGAATACTATAAACACACTCTGT
CTTGGGAAGAAAGAACAGTACTTCCTCTACGAAAGGCATATAAACAGGCA
TTTGAGGGGATCTCCTTCCCAATCAACCAGTTATTGGCTATCCTAGTTGC
TACTGTTTTTGTAAAAGTCAATAGCAGTATGGGCCTTCCTACCTTTCCTA
GGAATTTCCTCAATATATGTTGTTGGTTTATTATCGTCCTGTTCATCTTA
GCTTTTGCAGAAAGCCTTCGTCATTTGCGTTGGATGAATCTGATCTTCTC
TGCAGCGATTTTATTCTCTCCAGTACTCTTTCATATTCCCGTAGAATCTC
CCATGTTCTTGCCGATCATCGTTACAGGACTCATTCTAATTATTCTATCT
ATAGGAAAGAGACGAAGAACTAAACGCAAACTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy