Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR195 IGR194 IGR188 IGR191 IGR193 IGR184 IGR185 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 CPn0229 CPn0233 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 CPn0229 CPn0234 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0233 CPn0223 CPn0221 CPn0220 CPn0225 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0228

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dsbG?  

Definition:
conserved hypothetical protein; potential disulfide bond chaperone

Gene Start:
266110

Gene Stop:
265409

Gene Length:
702

Molecular Weight*:
26099

pI*:
6.80

Net Charge*:
-1.45

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
In E. coli, DsbG is a potential thiol:disulfide interchange protein.

Blast Summary:  PSI-Blast Search
CPn0228 is orthologously related to CT177: residues 1-228 of CPn0228 are 71% similar to residues 51-278 of CT177, a conserved hypothetical protein (basic) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1651
COG name: Protein-disulfide isomerases DsbC/DsbG
Functional Class:  O
The phylogenetic pattern of COG1651 is a----Q-cEBRhuj----inX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LNKKILVLCTAMFFIVCFGFLIHKKHTILPPKAHIPTNAKHFPTIGNPYA
PINITVFEEPSCSACAEFTTEVFPLLKKHYIDTGEISFTLIPVCFIRGSK
PAAQALLCIYHHDPRQADIDAYMEYFHRILTYPKEEGSHWATPEVLTKLA
EGLKINSGRSVNPKGLEQCIASGQYNEQIKKNNLYGSQVLGGQLATPTAV
VGDYLIEDPTFHEIERAIQHIRQLQAVEGDHDD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATAAAAAGATCCTAGTTCTGTGCACTGCGATGTTTTTTATCGTTTG
CTTTGGCTTTCTAATACATAAAAAACATACGATTCTACCCCCTAAAGCTC
ATATTCCTACAAATGCAAAACACTTTCCTACCATAGGGAATCCTTATGCT
CCTATAAACATAACAGTATTTGAGGAGCCTTCTTGTTCTGCTTGTGCAGA
ATTCACTACTGAAGTGTTCCCCTTGTTAAAGAAGCACTATATTGATACTG
GAGAGATTTCTTTTACTTTGATTCCTGTCTGCTTTATTCGCGGGTCTAAA
CCTGCAGCTCAAGCATTGCTATGTATTTATCATCACGATCCACGTCAGGC
AGATATAGACGCTTATATGGAATATTTCCATCGTATTTTGACTTATCCTA
AAGAGGAAGGCTCACACTGGGCAACTCCTGAGGTTCTTACAAAGTTGGCT
GAGGGTTTAAAAATAAATTCTGGACGTAGTGTTAATCCTAAAGGCTTGGA
ACAGTGTATCGCTTCAGGACAGTATAACGAGCAGATTAAGAAGAATAATC
TATACGGGTCTCAGGTTTTAGGAGGACAGTTAGCAACACCAACGGCTGTA
GTCGGAGACTACTTAATCGAAGATCCTACGTTTCATGAAATAGAAAGAGC
GATTCAACATATTCGTCAGCTGCAAGCTGTTGAAGGAGATCATGATGATT
AA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy