Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR194 IGR188 IGR191 IGR183 IGR193 IGR184 IGR185 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0223 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0227

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
roxB?  dsbB?  nhaB?  

Definition:
conserved hypothetical protein (possible disulfide bond formation protein B)(possible disulfide oxidoreductase)

Gene Start:
265416

Gene Stop:
265006

Gene Length:
411

Molecular Weight*:
15253

pI*:
8.30

Net Charge*:
3.64

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Secondary Evidence:
MISSIAKAS D., GEORGOPOULOS C., RAINA S. 1993. "Identification and characterization of the Escherichia coli gene dsbB, whose product is involved in the formation of disulfide bonds in vivo." PROC. NATL. ACAD. SCI. U.S.A. 90:7084-7088.
Guilhot, C., G. Jander, N.L. Martin, J.R. Beckwith. 1995. "Evidence that the pathway of disulfide bond formation in Escherichia coli involves interactions between the cysteines of DsbB and DsbA." Proc. Natl. Acad. Sci. USA 92:9895-9899.

Comment:
DsbB appears to reoxidize DsbA after its disulfide donations to periplasmic proteins.

From Swiss-Prot:
FUNCTION: REQUIRED FOR DISULFIDE BOND FORMATION IN SOME PERIPLASMIC PROTEINS SUCH AS PHOA OR OMPA. ACTS BY OXIDIZING THE DSBA PROTEIN.
SUBCELLULAR LOCATION: INTEGRAL MEMBRANE PROTEIN. INNER MEMBRANE.

Blast Summary:  PSI-Blast Search
CPn0227 is orthologously related to CT176: residues 1-133 of CPn0227 are 72% similar to residues 1-133 of CT176, a conserved hypothetical protein (potential disulfide oxidoreductase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1495
COG name: Disulfide bond formation protein DsbB
Functional Class:  O
The phylogenetic pattern of COG1495 is --------eB-huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 135 (E-value = 8.6e-64) place CPn0227 in the DsbB family which is described as Disulfide bond formation protein DsbB (PF02600)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
12  
30
transmembrane  
37  
55
transmembrane  
67  
84
transmembrane  
105  
127

PDB Hit:


Gene Protein Sequence:
MINFIRSYALYFAWAISCAGTLISIFYSYILNVEPCILCYYQRICLFPLT
VILGISAYREDSSIKLYILPQAVLGLGISIYQVFLQEIPGMQLDICGRVS
CSTKIFLFSYVTIPMASVVAFGAIVCLLVLTKKYRG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAATTTTATCCGTAGCTATGCTTTATATTTTGCTTGGGCTATTTC
TTGTGCTGGCACTTTGATTAGCATTTTTTATAGCTATATTCTTAACGTAG
AGCCTTGTATTCTTTGCTACTATCAGAGAATCTGTCTGTTCCCACTCACT
GTAATTTTAGGAATTTCAGCTTATCGCGAGGACTCTTCAATCAAACTGTA
TATCCTTCCTCAGGCAGTCCTAGGCTTAGGGATTTCTATCTACCAAGTTT
TCTTGCAAGAAATTCCAGGGATGCAATTGGATATCTGCGGTAGAGTCTCC
TGCTCAACAAAGATCTTTCTTTTTAGCTACGTGACGATCCCTATGGCGTC
TGTTGTTGCTTTCGGTGCCATTGTATGTCTCTTAGTTCTTACAAAAAAAT
ATAGAGGATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy