Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR188 IGR191 IGR183 IGR193 IGR184 IGR185 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0232 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0223 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0226

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific conserved hypothetical protein

Gene Start:
264566

Gene Stop:
264970

Gene Length:
405

Molecular Weight*:
15309

pI*:
7.50

Net Charge*:
0.85

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 55-121 are 47% similar to residues 51-115 of CPn0221.
Residues 4-114 are 36% similar to residues 6-110 of CPn0223.
Residues 6-76 are 39% similar to residues 4-68 of CPn0224.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MPYYANTLEFIQGTQSLCPLFKYGFVRHHYKGQLEIEDASHDWDFLEPPS
TWKRTLLAAIPILGSVIGLGRLFSIWSIREPQDSQEYKSIFWHTLCAVLE
ILGLGIVALILKILATFIMAMPGLKRVATFLFYS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCATACTATGCAAACACCCTGGAGTTCATCCAGGGAACTCAAAGTCT
ATGTCCTTTATTCAAATATGGGTTTGTAAGACACCATTATAAAGGACAAC
TAGAAATCGAAGATGCTTCTCACGACTGGGATTTCTTAGAACCCCCTTCT
ACATGGAAACGCACTCTCCTTGCTGCAATTCCTATTCTAGGATCCGTCAT
AGGTCTAGGAAGACTCTTTAGCATCTGGTCCATTAGAGAACCCCAGGACT
CTCAAGAATACAAGTCTATATTCTGGCACACTCTATGTGCTGTCCTAGAA
ATTTTAGGACTCGGGATTGTAGCTCTTATTCTAAAGATCTTAGCAACCTT
TATTATGGCAATGCCAGGTTTAAAGAGAGTTGCAACTTTCCTATTTTATT
CTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy