Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ala_1 tRNA_Ile_1 IGR192 IGR189 IGR190 IGR187 IGR186 IGR188 IGR191 IGR183 IGR193 IGR182 IGR184 IGR185 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 dsbG?, - CPn0228 nrtC,tauB, - CPn0231 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 roxB?,dsbB?,nhaB?, - CPn0227 CPn0230 CPn0223 CPn0221 CPn0220 CPn0225 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0225

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
263873

Gene Stop:
264544

Gene Length:
672

Molecular Weight*:
24098

pI*:
9.60

Net Charge*:
5.82

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarities to a known sequence in any other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0225 is weakly similar to CPn1054, CPn0041, CPn0010, CPn0011 and CPn1055. They are all hypothetical proteins.

Pfam Summary:  Pfam Search
Residues 9 to 207 (E-value = 1.3e-73) place CPn0225 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
56
transmembrane  
61  
85
coil-coil  
166  
223

PDB Hit:


Gene Protein Sequence:
MTKNAINSQTTTPQPNLTDAEPIASRAQCKSIAVIISLFALGMLLLCLGI
ILISIPIPGLAAQVALGLGIVSLILGIALANIGFLCLLLRCKQVPQKPDT
LPSESSKQPSEGSTPTALPWQAGEFLEKVQVSATPILLPKNKDEELSAKV
MKEGAEAASSIKQAVLESTEKLIDARKQEESRREARKKIVAEEAEASRKR
IQQQMAADQEALRKRKEEVAKRK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAAAATGCTATAAATTCACAAACAACAACCCCACAACCCAATTT
AACAGACGCAGAACCTATCGCTAGCCGTGCGCAATGTAAATCAATAGCGG
TAATCATTAGTTTGTTTGCTCTGGGAATGCTCCTACTCTGTCTGGGGATA
ATTCTTATTTCCATACCTATTCCTGGACTTGCTGCACAAGTTGCTCTCGG
CCTCGGAATAGTAAGTTTAATCTTAGGAATTGCTTTAGCCAACATAGGTT
TCCTATGTTTATTACTTAGATGCAAGCAGGTTCCCCAAAAACCCGATACA
TTGCCCTCTGAAAGCTCTAAACAGCCTTCCGAGGGAAGCACTCCCACCGC
ACTCCCATGGCAAGCTGGAGAATTTTTAGAAAAAGTACAAGTATCTGCAA
CCCCTATACTCCTTCCCAAGAACAAAGATGAAGAGTTATCAGCAAAAGTT
ATGAAAGAAGGAGCCGAAGCAGCTTCTTCAATTAAACAAGCTGTTCTAGA
ATCTACAGAGAAATTAATCGATGCTAGAAAACAAGAGGAGAGCCGACGAG
AGGCTAGGAAAAAAATCGTGGCGGAGGAGGCTGAAGCATCTAGAAAACGT
ATTCAACAGCAAATGGCAGCCGACCAAGAAGCGTTAAGAAAACGAAAAGA
AGAAGTAGCTAAAAGAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy