Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR192 IGR189 IGR190 IGR187 IGR186 IGR188 IGR191 IGR183 IGR182 IGR184 IGR185 CPn0218 CPn0230 dsbG?, - CPn0228 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0218 CPn0230 dsbG?, - CPn0228 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0218 CPn0230 dsbG?, - CPn0228 roxB?,dsbB?,nhaB?, - CPn0227 roxB?,dsbB?,nhaB?, - CPn0227 CPn0223 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0223

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
262956

Gene Stop:
263336

Gene Length:
381

Molecular Weight*:
13939

pI*:
5.70

Net Charge*:
-2.43

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical proteins in C.pneumoniae:

Residues 2-118 are 41% similar to CPn0221.
Residues 6-110 are 36% similar to CPn0226.
Residues 35-118 are 34% similar to CPn0220.
Residues 6-121 are 29% similar to CPn0830.
Residues 12-78 are 46% similar to CPn0224.
This protein is also weakly paralogous to CPn0829 and CPn0277.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
99  
119

PDB Hit:


Gene Protein Sequence:
MLIGRYSSDDQFTEATKNTPTIIKLGFVRDNLEGLTNPISEIVSETSSSI
KDSVLRSLPILGSILGCARLYSTLSTNDPLDETQEKIWHTIFGALETLGL
GILILLFKIIFVILHCIFHLVIGFCK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAATAGGCAGATACAGTAGTGATGACCAATTCACTGAAGCAACAAA
AAACACCCCAACCATAATTAAGCTAGGTTTTGTTAGAGATAATCTCGAGG
GATTAACGAACCCTATCTCTGAAATCGTCTCGGAAACCTCCTCTTCTATT
AAAGATTCCGTTCTTCGCTCTCTTCCTATTTTAGGGTCCATTTTAGGATG
CGCCCGACTTTACAGCACACTCTCTACAAATGATCCTCTTGACGAAACTC
AAGAAAAGATTTGGCACACTATATTTGGAGCCTTAGAAACCTTAGGCTTA
GGGATTCTCATCCTCTTATTTAAAATTATTTTTGTTATATTACACTGCAT
ATTTCATCTAGTTATTGGGTTCTGCAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy