Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR192 IGR189 IGR190 IGR187 IGR186 IGR188 IGR191 IGR183 IGR181 IGR182 IGR184 IGR185 CPn0218 CPn0230 dsbG?, - CPn0228 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0218 CPn0230 dsbG?, - CPn0228 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0218 CPn0230 dsbG?, - CPn0228 roxB?,dsbB?,nhaB?, - CPn0227 roxB?,dsbB?,nhaB?, - CPn0227 CPn0223 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0222

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
262504

Gene Stop:
262845

Gene Length:
342

Molecular Weight*:
13743

pI*:
10.20

Net Charge*:
11.38

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Two weak hits in gapped BLAST; residues 4-112 are 33% similar to residues 90-200 of Y47K_BPCHP; residues 22-110 are 39% similar to residues 43-139 of VG2_SPV4.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 4-112 are 33% similar to a defined domain of Y47K_BPCHP, defined as a protein gene ORF4.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LRELNAFELTQPEEYRNRWVLMPCLKCRFCRTQHAKVWSYRCVHEASLYE
KNCFLTLTYDDKHLPQYGSLVKLHLQLFLKRLRKMISPHKIRYFECGAYG
TKLQRPHYHLLLS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCGAGAATTAAATGCTTTTGAATTAACTCAACCTGAAGAGTATCGAAA
CCGTTGGGTTTTGATGCCTTGTCTTAAGTGTCGTTTTTGTAGAACGCAAC
ATGCAAAAGTCTGGTCTTATCGTTGTGTCCATGAAGCTTCTTTGTATGAG
AAAAATTGTTTTCTTACTTTGACTTATGATGATAAGCATTTACCTCAGTA
TGGTTCGTTGGTAAAGCTGCATTTACAGCTGTTTCTTAAGAGATTAAGAA
AGATGATTTCTCCTCATAAAATTCGTTATTTTGAATGTGGTGCGTATGGA
ACCAAATTACAAAGACCTCATTATCATCTACTTTTATCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy