Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR189 IGR190 IGR187 IGR186 IGR180 IGR188 IGR191 IGR183 IGR181 IGR182 IGR184 IGR185 CPn0216 CPn0218 dsbG?, - CPn0228 CPn0215 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0216 CPn0218 dsbG?, - CPn0228 CPn0215 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0218 dsbG?, - CPn0228 CPn0215 roxB?,dsbB?,nhaB?, - CPn0227 roxB?,dsbB?,nhaB?, - CPn0227 CPn0216 CPn0223 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0229 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0221

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
261657

Gene Stop:
262067

Gene Length:
411

Molecular Weight*:
15302

pI*:
6.10

Net Charge*:
-2.19

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any known sequence in other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0221 is similar to CPn0223, CPn0226, CPn0220, CPn0830, CPn0829, CPn0224, and CPn0277. They are all hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
55  
136

PDB Hit:


Gene Protein Sequence:
MVNRYKSSAEFSADHYYDDNLVRMGYKRNLRGLAPVENEVCLFEENNLLE
SVMASIPIMGSILGLGRLHSVWSTQDPKDSKISIIFHTALGILETLGLGI
IVLLIKITITILLILFTPCLLCYFMYSAAYSDFHPI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAAACAGATACAAGAGCTCTGCAGAATTTTCCGCTGATCATTACTA
TGATGACAACCTGGTTCGGATGGGGTATAAAAGAAACTTAAGAGGACTAG
CTCCTGTGGAGAATGAAGTCTGTCTTTTTGAGGAGAATAACCTACTCGAA
TCTGTCATGGCGTCTATACCAATTATGGGATCGATACTTGGCTTAGGCAG
ACTTCATAGTGTTTGGTCTACACAGGACCCTAAAGATAGTAAAATCTCTA
TAATTTTCCATACTGCACTTGGAATTCTAGAAACCCTAGGTCTAGGAATC
ATTGTTCTCCTTATTAAAATAACGATTACTATTCTCCTTATTCTATTTAC
TCCATGTCTTCTCTGTTATTTCATGTATTCTGCTGCTTATAGTGATTTTC
ATCCTATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy