Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR189 IGR190 IGR187 IGR186 IGR180 IGR188 IGR183 IGR181 IGR182 IGR184 IGR185 CPn0216 CPn0218 dsbG?, - CPn0228 CPn0215 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0216 CPn0218 dsbG?, - CPn0228 CPn0215 CPn0224 CPn0222 CPn0223 CPn0226 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0216 CPn0218 dsbG?, - CPn0228 CPn0215 roxB?,dsbB?,nhaB?, - CPn0227 roxB?,dsbB?,nhaB?, - CPn0227 CPn0223 CPn0221 CPn0220 CPn0225 ypdP, - CPn0217 tgt, - CPn0219 CPn0224 CPn0222 CPn0226
* Calculated from Protein Sequence

Gene ID: CPn0220

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
260696

Gene Stop:
261241

Gene Length:
546

Molecular Weight*:
20264

pI*:
10.70

Net Charge*:
16.19

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Weak paralogy to several hypothetical protein sequences in C.pneumoniae:

Residues 28-116 are 37% similar to residues 24-117 of CPn0221.
Residues 34-115 are 34% similar to residues 35-118 of CPn0223.
Residues 50-109 are 43% similar to residues 53-116 of CPn0226.
Residues 52-115 are 34% similar to residues 95-161 of CPn0830.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
95  
113

PDB Hit:


Gene Protein Sequence:
MSKESIRSYSEISTPTPIFRETPSKEGVAYKLQLRSPAKDCILRNRVSLK
GALLRSIPFYGSFLGAKRIHSAWSAKDAPCTTRVYHYLVGGLELLGLGVV
VLACKVLATALKFLFSKASSKIKQMKWREKARNLAAKDTVQSIKEFCSVD
LTSCFTRCFRLRNRVVEEGASENQTVREIIV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGAAGGAAAGCATTAGAAGTTATTCTGAAATTTCTACTCCAACGCC
GATATTCAGAGAAACGCCCTCGAAAGAAGGCGTGGCATATAAACTTCAGC
TTAGATCACCAGCTAAAGACTGCATACTCAGGAATAGAGTATCTCTAAAA
GGAGCTCTATTAAGATCCATTCCATTTTACGGATCATTCTTAGGTGCTAA
AAGAATCCATAGTGCCTGGTCTGCAAAAGATGCCCCCTGCACAACTAGAG
TGTATCACTACCTAGTCGGTGGGCTTGAGTTATTGGGACTCGGGGTTGTT
GTTCTAGCGTGTAAAGTACTCGCCACCGCTCTAAAGTTTTTATTCTCTAA
AGCCTCCTCGAAGATAAAACAAATGAAATGGCGAGAGAAAGCGCGCAACC
TAGCAGCCAAAGATACGGTACAATCAATAAAAGAGTTCTGTTCCGTTGAT
CTTACATCTTGCTTTACAAGATGTTTCAGGCTTCGAAATAGAGTGGTAGA
GGAAGGTGCATCTGAAAACCAAACAGTAAGAGAGATCATTGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy