Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR179 IGR178 IGR186 IGR177 IGR180 IGR183 IGR181 IGR182 IGR184 IGR185 CPn0213 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0222 CPn0223 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0213 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0222 CPn0223 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0213 CPn0223 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0222
* Calculated from Protein Sequence

Gene ID: CPn0217

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ypdP  

Definition:
conserved hypothetical protein

Gene Start:
257896

Gene Stop:
258582

Gene Length:
687

Molecular Weight*:
25624

pI*:
8.80

Net Charge*:
3.80

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0217 is orthologously related to CT140: residues 1-225 of CPn0217 are 51% similar to residues 1-220 of CT140, a predicted conserved hypothetical protein from C. trachomatis.
CPn0217 is also similar to conserved hypothetical proteins from Archaeoglobus fulgidus (AE000958), Borrelia burgdorferi (AE001118) and Bacillus subtilis (P54163).

COGS Summary:  COGS Search
BeTs to 5 clades of COG1738
COG name: Uncharacterized ACR, YhhQ family
Functional Class:  S
The phylogenetic pattern of COG1738 is a-----V-eb-h----O-iN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 55 to 206 (E-value = 5.6e-63) place CPn0217 in the DUF165 family which is described as Uncharacterized ACR, YhhQ family COG1738 (PF02592)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
12  
29
transmembrane  
34  
51
transmembrane  
56  
73
transmembrane  
91  
108
transmembrane  
131  
150
transmembrane  
171  
192
transmembrane  
197  
214

PDB Hit:


Gene Protein Sequence:
LKGFLSVNELIFGFQTFSVVVLGVFFASRGKAWLTGWLSLLSSIMNVFVL
KQIHLWGFEVTSADVYVIGLLTCLNYAREHYEKNDINDAMLCSWVISIAF
LVLTQLHLFLIPSPNDSSQEHFLALFSSTPRIVVASLVTLIFVQIVDIKL
FTFLQRVFSKKYFAMRSTISLLFSQLIDTIIFSFLGLYGLVSNLCDVMIF
AMLVKGIVITLAIPTLTVTKAVLDRRSS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAAGGATTTTTATCTGTGAATGAATTAATTTTTGGATTCCAGACTTT
CTCTGTTGTAGTTTTAGGAGTTTTCTTTGCCTCTAGAGGAAAGGCTTGGC
TTACAGGATGGCTATCGCTGCTCTCAAGCATCATGAATGTCTTTGTTCTA
AAACAAATCCATCTCTGGGGTTTTGAAGTTACGTCTGCTGATGTCTATGT
GATTGGTTTGCTTACTTGTCTAAATTATGCCCGAGAGCACTACGAAAAAA
ACGATATCAATGATGCTATGCTATGCTCCTGGGTCATCTCCATAGCGTTT
TTGGTTCTCACCCAGCTACACCTATTTTTAATCCCCTCACCTAACGACTC
TTCTCAAGAGCATTTCTTAGCTCTTTTTTCTTCTACTCCAAGAATCGTAG
TAGCCTCTCTGGTCACTTTAATTTTCGTTCAGATCGTGGATATAAAACTC
TTTACCTTCCTTCAACGAGTTTTTTCAAAGAAATATTTTGCAATGCGCTC
AACAATTTCCCTGCTCTTTTCTCAACTCATTGATACCATAATATTTTCAT
TTTTAGGATTGTATGGATTGGTCAGCAATCTTTGTGACGTTATGATCTTT
GCAATGCTAGTCAAAGGCATTGTAATTACACTAGCTATACCGACTCTAAC
AGTAACTAAAGCCGTTTTAGATCGTCGTTCCTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy