Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR175 IGR179 IGR178 IGR177 IGR176 IGR180 IGR183 IGR181 IGR182 IGR184 IGR185 CPn0213 CPn0211 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0213 CPn0211 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0213 CPn0211 CPn0216 CPn0218 CPn0212 CPn0214 CPn0215 CPn0221 CPn0220 ypdP, - CPn0217 tgt, - CPn0219
* Calculated from Protein Sequence

Gene ID: CPn0216

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
257608

Gene Stop:
257171

Gene Length:
438

Molecular Weight*:
16151

pI*:
4.30

Net Charge*:
-8.10

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
81

PDB Hit:


Gene Protein Sequence:
MNPVTFDRIQVDFIPEDTSLRINSYIVAGGLLILGVVLSILSVICLDIGL
VGLSAGAAFTLGLGCLIFALFLFSFSLILLLSQEKRVPDVLSLYLEKEVP
QYETPLYKEDLESERDMSAISERLGIIEEKLRIAEKFRYSDSVFV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCCTGTGACATTTGATCGTATTCAAGTTGATTTTATTCCTGAAGA
CACTTCTTTGAGAATCAACTCCTATATAGTGGCGGGGGGCTTACTTATTC
TTGGAGTTGTCTTATCCATTTTATCTGTCATTTGTTTGGATATAGGTCTG
GTTGGACTTTCTGCGGGGGCTGCTTTTACTCTAGGACTCGGCTGCTTGAT
TTTTGCTCTTTTTCTTTTCTCTTTTAGCCTGATTTTGCTCTTATCTCAAG
AGAAACGTGTTCCTGATGTACTTTCTCTCTATCTTGAAAAAGAGGTTCCT
CAATATGAAACTCCCTTATATAAAGAGGATCTTGAATCTGAGAGAGACAT
GAGTGCGATTTCTGAGCGTCTAGGAATTATTGAAGAAAAGCTGAGGATAG
CGGAGAAATTTCGTTATAGCGATAGTGTCTTTGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy