Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR175 IGR179 IGR178 IGR177 IGR176 IGR180 IGR174 IGR183 IGR181 IGR182 IGR184 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0220 ypdP, - CPn0217 tgt, - CPn0219 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0220 ypdP, - CPn0217 tgt, - CPn0219
* Calculated from Protein Sequence

Gene ID: CPn0215

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
257015

Gene Stop:
255756

Gene Length:
1260

Molecular Weight*:
48024

pI*:
5.00

Net Charge*:
-13.82

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0215 is weakly similar to rat synaptonemal complex protein-1 (SCP-1): residues 94-318 are 25% similar to SCP-1.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0215 is weakly similar to CPn0011, a hypothetical protein: residues 12-117 are 38% similar to CPn0011.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
87
coil-coil  
187  
242
coil-coil  
259  
324
coil-coil  
355  
386

PDB Hit:


Gene Protein Sequence:
MSSAIARDCFPSPSPQPSSTLGVHPPKYKSLILSVSLIVLGVLLLCVGML
LLVNAIFSFSVLTVGLGGAGVFLGSLLLILGLIFFVSYHRKLSEATRSLE
QKITLEYQPWADLRKELNEVQEWSNFLLDEWEDFKEVVAQHKSQFATFEG
DLLLFGREVEKYETIWKELDGRDVALLTELKNIWGPLEFLRKKGDRLQCE
IDKLRKEVMKVGKSGLKLACELTKFKSALKDVKIEQECYRDKRKVEKLEV
FPEGYRRELLEVLKTRLSVEKEIQLFEEVVSAFEEKLASLHRTVFSEEEL
QEALDKAKAELLDIQVRKSVVEDLSCEPTLIQYHLLRLYEVQCRIVEQFL
TQTFSSEQEKVLEEYEALKARIRKTLRVKLDQVRANVAFVASTTDLLSES
ESLDGNDSVFEDAHDDFLD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAGCGCTATTGCCCGTGATTGTTTCCCGTCTCCGTCCCCCCAACC
CTCTTCAACTTTAGGAGTTCATCCACCTAAATATAAGTCTCTGATCCTTT
CTGTATCTTTGATTGTCTTGGGTGTTCTCCTGTTATGTGTGGGGATGCTC
TTGCTTGTAAATGCTATTTTTAGTTTTTCTGTCTTGACTGTAGGACTCGG
GGGCGCAGGTGTTTTCTTAGGAAGTTTACTCTTGATTTTGGGGCTGATTT
TCTTTGTCTCTTATCACCGGAAACTTTCAGAAGCCACGAGATCATTAGAA
CAAAAAATTACTTTAGAATATCAACCGTGGGCAGATCTTAGAAAAGAGCT
TAATGAAGTTCAGGAATGGAGCAATTTTCTATTAGATGAGTGGGAGGACT
TTAAAGAGGTTGTCGCTCAACATAAGAGTCAGTTCGCTACATTTGAGGGG
GATCTTCTTCTGTTTGGACGTGAAGTCGAAAAATACGAGACGATTTGGAA
GGAACTAGACGGAAGGGATGTAGCGTTACTTACTGAGTTAAAGAATATCT
GGGGGCCTCTTGAATTTTTAAGGAAAAAAGGAGATCGCCTTCAATGTGAA
ATAGATAAGCTTCGAAAAGAAGTCATGAAAGTAGGGAAATCTGGATTGAA
GCTTGCTTGTGAGTTGACTAAGTTTAAATCTGCTTTAAAAGACGTAAAGA
TAGAACAGGAATGTTATCGAGACAAAAGGAAAGTAGAGAAACTGGAGGTG
TTTCCCGAAGGTTATAGGAGGGAACTATTAGAAGTCCTAAAAACAAGGCT
TTCCGTTGAAAAAGAGATTCAACTTTTCGAAGAAGTTGTGAGTGCATTTG
AAGAAAAATTAGCATCTTTACACAGAACCGTCTTTTCTGAAGAAGAGCTG
CAAGAAGCACTAGATAAAGCTAAAGCAGAACTTCTTGATATTCAAGTCAG
GAAATCGGTAGTAGAAGATCTGAGTTGTGAACCAACTCTTATTCAGTATC
ATTTATTGCGCCTTTATGAAGTTCAATGTCGTATTGTTGAGCAGTTTTTA
ACTCAAACTTTCTCTTCGGAACAAGAGAAAGTCTTAGAGGAGTATGAGGC
CTTAAAAGCACGTATTCGCAAGACTCTTAGAGTTAAATTGGATCAAGTCA
GAGCAAATGTGGCATTTGTTGCATCTACGACGGATTTGTTGAGTGAGAGC
GAATCATTAGATGGTAATGATAGTGTGTTTGAAGATGCTCACGATGATTT
CTTGGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy