Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR175 IGR179 IGR178 IGR177 IGR176 IGR180 IGR174 IGR181 IGR182 IGR173 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 tgt, - CPn0219 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 tgt, - CPn0219 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0218 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 tgt, - CPn0219 pfpA,pfkA_1, - CPn0208
* Calculated from Protein Sequence

Gene ID: CPn0214

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
255657

Gene Stop:
254443

Gene Length:
1215

Molecular Weight*:
46795

pI*:
6.40

Net Charge*:
-3.78

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Several very weak (insignificant?) hits in gapped BLAST to yeast sequence; e.g. residues 76-402 are 21% similar to (Z74105) ORF YDL058w [Saccharomyces cerevisiae]. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
53
coil-coil  
230  
257
coil-coil  
335  
404

PDB Hit:


Gene Protein Sequence:
VVVVALFILGIFFLSGSLAFLVHTSCGVLLGAALPILCIGLVLLAVALIV
FLCHKHKTRQDLDYYDQDLDSLVIHKKEIPNDISELRVTFEKLQNLFQFH
TKDFSDLSQELQGKFINCMEKWLTLEDEVTKFLIVRDRFLETRRNFTTFG
EQVKGIQSNIFDLHEEKSSLYLELYRLRKDLQVLLNFFLLPPGILKVDYD
EIEAIKGLFIRLTSRLDKLDVKAQERKKFINEMSREFKEVEKAFDIVDRA
TKKLMDRAKKESPARLFMGRTESLLEMKKNEEALKNQGLDPENLSHPELF
SPYQQLLILNYLNSEIVLHHYEFLISGTVTSGLTLEECENRMRAASTGLN
ALLVRKLQFRGAIKSAYFEKLTEIEKELRSLQDVIKSLELELIHKIKDIV
TEET$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTGGTTGTCGCTTTATTTATCCTTGGGATTTTCTTTTTATCTGGTTC
TCTTGCATTCCTTGTTCATACGTCTTGCGGAGTTCTTTTAGGAGCGGCGC
TTCCCATACTTTGCATAGGTCTTGTTTTATTGGCTGTAGCTCTTATTGTT
TTCTTATGTCACAAACACAAGACTCGTCAAGATTTAGATTATTATGATCA
AGATTTAGATTCTTTGGTGATTCATAAGAAAGAGATCCCCAATGACATCT
CTGAGTTGCGGGTAACATTTGAAAAGTTGCAAAATCTGTTTCAGTTCCAT
ACGAAAGATTTCTCTGATCTAAGCCAAGAGCTTCAGGGTAAATTTATCAA
TTGCATGGAGAAATGGCTAACTTTAGAAGACGAAGTGACTAAATTTCTTA
TTGTTCGAGATAGATTTTTAGAAACCAGAAGAAATTTTACCACTTTTGGA
GAACAGGTTAAAGGGATCCAAAGCAATATTTTTGATTTGCATGAGGAAAA
GTCTTCATTATATTTAGAATTGTATAGGCTTAGGAAAGACCTCCAAGTTC
TATTAAATTTTTTTCTGCTCCCCCCAGGTATACTCAAGGTAGATTATGAT
GAAATTGAGGCTATCAAAGGTCTGTTTATAAGATTAACCTCTAGATTAGA
TAAGCTTGATGTGAAAGCTCAGGAACGTAAGAAGTTCATTAATGAAATGA
GTAGGGAATTTAAAGAAGTAGAGAAAGCTTTTGATATTGTCGATAGGGCA
ACAAAAAAGCTTATGGATAGAGCCAAGAAAGAAAGTCCGGCACGTCTTTT
CATGGGTAGAACTGAGTCTCTCTTAGAAATGAAAAAAAATGAAGAAGCCC
TTAAAAATCAGGGGCTAGATCCTGAAAATCTTTCCCATCCTGAACTTTTT
AGTCCGTATCAACAGCTTTTAATTTTGAATTATTTAAATAGCGAAATAGT
TCTGCATCATTATGAGTTCCTTATTTCTGGAACAGTAACTTCTGGCCTAA
CTCTTGAAGAATGTGAAAATCGAATGAGGGCGGCTTCTACTGGGTTGAAC
GCCCTTCTGGTGCGTAAGCTCCAGTTCAGAGGTGCTATAAAATCTGCGTA
TTTTGAAAAACTCACAGAGATTGAAAAAGAGTTACGATCACTTCAAGACG
TAATAAAGTCATTGGAACTAGAACTGATCCATAAGATAAAAGATATAGTG
ACAGAAGAAACTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy