Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR175 IGR179 IGR178 IGR177 IGR176 IGR180 IGR174 IGR181 IGR172 IGR173 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ypdP, - CPn0217 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208
* Calculated from Protein Sequence

Gene ID: CPn0212

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
254066

Gene Stop:
252885

Gene Length:
1182

Molecular Weight*:
45128

pI*:
5.30

Net Charge*:
-10.64

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No strong evidence of paralogs in C.pneumoniae, except CPn0212 shares a region predicted to be a transmembrane region with CPn0211: residues 39-88 of CPn0212 are 38% similar to residues 37-90 of CPn0211, a hypothetical.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
35  
59
transmembrane  
64  
84
coil-coil  
169  
207
coil-coil  
275  
307

PDB Hit:


Gene Protein Sequence:
VVVSIYSEILSFSELTSCKHSLFPFGPIETASIRIHHVFNVVIVCLIILG
TLFVCLGMVFLGVFSTYLLGMSSMILGLLLISIGLALLKFKERYGLEPKE
LFGVEGGFDKKLPSEIIQMQDQIADLARELDLEQKKDTLIRGFSARLDVL
EGSKTEKKQILKIGVPRNLSEIQERAQEQNSILEQCKEALLFRRKSAQEI
FKKLYDRKAAFWRSYREDLWCYSEIHVSKKALSNLYIGDVFEGTAPHFLM
EAYAMCRTAKNLRNYVKVCVEDMRVNEEKKRAKQLSVSELLCCCTEIETD
LENETNLFTSDSEDVLEEYQIHCIRVTMLHALWAIYNDEVVSRKPIDTLD
RVRARMAVEDCIETFEELQMCVVHTKTLELEIAQLYVDILLEA$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGTTGTGTCTATTTATTCGGAGATATTAAGTTTTTCAGAACTTACTTC
TTGTAAACACAGTCTTTTCCCTTTTGGGCCTATAGAAACGGCGAGTATTC
GCATTCACCACGTCTTTAATGTCGTGATCGTTTGTCTTATTATTTTAGGG
ACTCTTTTCGTATGCCTGGGGATGGTATTCTTGGGAGTTTTCTCTACGTA
CCTTTTAGGGATGAGCAGCATGATTTTAGGGCTGCTCTTAATAAGTATAG
GATTGGCGCTTCTTAAATTTAAGGAGCGCTATGGATTAGAGCCTAAAGAG
CTATTTGGTGTTGAGGGAGGGTTCGATAAGAAGCTTCCTAGTGAGATTAT
ACAGATGCAGGATCAGATTGCTGATTTAGCAAGGGAGTTGGACTTAGAGC
AGAAAAAGGATACATTGATTCGTGGGTTTTCTGCACGACTCGATGTTTTG
GAAGGTTCTAAAACAGAGAAAAAACAGATTCTAAAGATAGGTGTTCCTCG
AAATCTAAGTGAAATTCAGGAGAGAGCCCAAGAGCAAAACTCTATTTTAG
AGCAGTGTAAAGAGGCACTATTATTTCGAAGAAAATCTGCTCAGGAGATC
TTCAAGAAGCTCTATGATAGGAAAGCTGCTTTTTGGAGATCCTACAGAGA
AGACCTTTGGTGCTATTCAGAAATTCATGTTTCAAAGAAAGCACTGAGTA
ATCTTTATATTGGTGATGTTTTTGAGGGAACTGCTCCCCATTTTCTTATG
GAAGCATATGCTATGTGCCGCACAGCAAAAAATTTGCGTAATTATGTAAA
AGTCTGTGTGGAAGATATGAGAGTGAATGAAGAAAAGAAAAGAGCAAAAC
AGCTATCGGTTTCAGAACTTCTGTGTTGTTGTACTGAGATTGAAACAGAC
TTAGAAAATGAAACGAATCTTTTTACGAGTGATTCTGAGGATGTTTTGGA
AGAATACCAAATCCACTGTATACGTGTGACTATGTTACATGCTTTATGGG
CGATATACAACGATGAGGTAGTATCTAGGAAACCAATAGATACTCTTGAC
AGGGTAAGGGCTCGGATGGCTGTGGAGGATTGTATTGAGACCTTTGAAGA
GCTACAAATGTGCGTAGTACATACAAAGACTTTAGAACTCGAGATTGCTC
AACTTTATGTGGATATCCTTCTAGAGGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy